Target Validation Information | |||||
---|---|---|---|---|---|
Target ID | T13453 | ||||
Target Name | Galanin receptortype 2 | ||||
Target Type | Research |
||||
Drug Potency against Target | Gal-B5 | Drug Info | Ki = 48 nM | [530680] | |
GalB2 | Drug Info | Ki = 51.5 nM | [530680] | ||
WTLNSAGYLLGPHAVGNHPSFSDKNGLTS-CONH2 | Drug Info | Ki = 9.8 nM | [530680] | ||
[N-Ac,des-Sar]Gal-B2 | Drug Info | Ki = 15.9 nM | [530680] | ||
(Sar)WTLNSAGYLLGPKK(Lys-stearoyl)K | Drug Info | Ki = 15 nM | [529952] | ||
GWTLNSAGYLLGPrPKPQQwFwLL-CONH2 | Drug Info | Ki = 0.6 nM | [530680] | ||
(Sar)WTLNSAGYLLGPKKKK | Drug Info | Ki = 24 nM | [529952] | ||
(Sar)WTLNSAGYLLGPKK(Lys-myristoyl)K | Drug Info | Ki = 18.2 nM | [529952] | ||
GWTLNSAGYLLGPPPALALA-CONH2 | Drug Info | Ki = 1.5 nM | [530680] | ||
[Sar1Ala]GAL-B2 | Drug Info | Ki = 35 nM | [530680] | ||
GALANTIDE | Drug Info | Ki = 1.1 nM | [530680] | ||
GWTLNSAGYLLGPHAV-NH2 | Drug Info | Ki = 13 nM | [529837] | ||
(Sar)WTLNSAGYLLGPKK(Lys-lauroyl)K | Drug Info | Ki = 16.1 nM | [529952] | ||
[Sar1Gly]GAL-B2 | Drug Info | Ki = 17.5 nM | [530680] | ||
GWTLNSAGYLLGPPPGFSPFR-CONH2 | Drug Info | Ki = 1.8 nM | [530680] | ||
GwTLNSAGYLLGPHAVGNHRSFSDKNGLTS-CONH2 | Drug Info | Ki = 218 nM | [530680] | ||
GWTLNSAGYLLGPRHYINLITRQRY-CONH2 | Drug Info | Ki = 1.4 nM | [530680] | ||
(Sar)WTLNSAGYLLGPKK(Lys-decanoyl)K | Drug Info | Ki = 14.4 nM | [529952] | ||
[N-Me,des-Sar]Gal-B2 | Drug Info | Ki = 20.2 nM | [530680] | ||
WTLNSAGYLL-CONH2 | Drug Info | Ki = 1.74 nM | [530680] | ||
(Sar)WTLNSAGYLLGPKK(Lys-palmitoyl)K | Drug Info | Ki = 51.5 nM | [529952] | ||
(Sar)WTLNSAGYLLGPKK(Lys-MPEG4)K | Drug Info | Ki = 20.5 nM | [529952] | ||
(Sar)WTLNSAGYLLGPKK(Lys-octanoyl)K | Drug Info | Ki = 14.9 nM | [529952] | ||
GALANIN | Drug Info | IC50 = 3.5 nM | [529569] | ||
References | |||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 529952 | J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 529952 | J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. | ||||
Ref 529952 | J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 529837 | J Med Chem. 2008 Dec 25;51(24):8038-47.Design, synthesis, and characterization of high-affinity, systemically-active galanin analogues with potent anticonvulsant activities. | ||||
Ref 529952 | J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 529952 | J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 530680 | J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. | ||||
Ref 529952 | J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. | ||||
Ref 529952 | J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. | ||||
Ref 529952 | J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues. | ||||
Ref 529569 | J Med Chem. 2008 Jul 24;51(14):4150-69. Epub 2008 Jun 28.Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.