Target Validation Information
Target ID T13453
Target Name Galanin receptortype 2
Target Type
Research
Drug Potency against Target Gal-B5 Drug Info Ki = 48 nM [530680]
GalB2 Drug Info Ki = 51.5 nM [530680]
WTLNSAGYLLGPHAVGNHPSFSDKNGLTS-CONH2 Drug Info Ki = 9.8 nM [530680]
[N-Ac,des-Sar]Gal-B2 Drug Info Ki = 15.9 nM [530680]
(Sar)WTLNSAGYLLGPKK(Lys-stearoyl)K Drug Info Ki = 15 nM [529952]
GWTLNSAGYLLGPrPKPQQwFwLL-CONH2 Drug Info Ki = 0.6 nM [530680]
(Sar)WTLNSAGYLLGPKKKK Drug Info Ki = 24 nM [529952]
(Sar)WTLNSAGYLLGPKK(Lys-myristoyl)K Drug Info Ki = 18.2 nM [529952]
GWTLNSAGYLLGPPPALALA-CONH2 Drug Info Ki = 1.5 nM [530680]
[Sar1Ala]GAL-B2 Drug Info Ki = 35 nM [530680]
GALANTIDE Drug Info Ki = 1.1 nM [530680]
GWTLNSAGYLLGPHAV-NH2 Drug Info Ki = 13 nM [529837]
(Sar)WTLNSAGYLLGPKK(Lys-lauroyl)K Drug Info Ki = 16.1 nM [529952]
[Sar1Gly]GAL-B2 Drug Info Ki = 17.5 nM [530680]
GWTLNSAGYLLGPPPGFSPFR-CONH2 Drug Info Ki = 1.8 nM [530680]
GwTLNSAGYLLGPHAVGNHRSFSDKNGLTS-CONH2 Drug Info Ki = 218 nM [530680]
GWTLNSAGYLLGPRHYINLITRQRY-CONH2 Drug Info Ki = 1.4 nM [530680]
(Sar)WTLNSAGYLLGPKK(Lys-decanoyl)K Drug Info Ki = 14.4 nM [529952]
[N-Me,des-Sar]Gal-B2 Drug Info Ki = 20.2 nM [530680]
WTLNSAGYLL-CONH2 Drug Info Ki = 1.74 nM [530680]
(Sar)WTLNSAGYLLGPKK(Lys-palmitoyl)K Drug Info Ki = 51.5 nM [529952]
(Sar)WTLNSAGYLLGPKK(Lys-MPEG4)K Drug Info Ki = 20.5 nM [529952]
(Sar)WTLNSAGYLLGPKK(Lys-octanoyl)K Drug Info Ki = 14.9 nM [529952]
GALANIN Drug Info IC50 = 3.5 nM [529569]
References
Ref 530680J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery.
Ref 530680J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery.
Ref 530680J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery.
Ref 530680J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery.
Ref 529952J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues.
Ref 530680J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery.
Ref 529952J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues.
Ref 529952J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues.
Ref 530680J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery.
Ref 530680J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery.
Ref 530680J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery.
Ref 529837J Med Chem. 2008 Dec 25;51(24):8038-47.Design, synthesis, and characterization of high-affinity, systemically-active galanin analogues with potent anticonvulsant activities.
Ref 529952J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues.
Ref 530680J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery.
Ref 530680J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery.
Ref 530680J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery.
Ref 530680J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery.
Ref 529952J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues.
Ref 530680J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery.
Ref 530680J Med Chem. 2010 Feb 25;53(4):1871-5.Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery.
Ref 529952J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues.
Ref 529952J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues.
Ref 529952J Med Chem. 2009 Mar 12;52(5):1310-6.Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues.
Ref 529569J Med Chem. 2008 Jul 24;51(14):4150-69. Epub 2008 Jun 28.Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.