Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T14592 | Target Info | |||
| Target Name | Apoptosis mediating surface antigen FAS (FAS) | ||||
| Synonyms | Tumor necrosis factor receptor superfamily member 6; TNFRSF6; FASLG receptor; FAS1; CD95; Apoptosis-mediating surface antigen FAS; Apo-1 antigen; APT1 | ||||
| Target Type | Clinical trial Target | ||||
| Gene Name | FAS | ||||
| Biochemical Class | Cytokine receptor | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | Nuclear transcription factor Y A/B/C (NF-Y) heterotrimer | ||||
| Classification | Superclass | beta-Scaffold Factors with Minor Groove Contacts | |||
| Class | Heteromeric CCAAT factors | ||||
| Family | Heteromeric CCAAT factors | ||||
| Regulation Type | Increase | ||||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Electrophoretic Mobility Shift Assay | [1] | |||
| UniProt ID | |||||
| Sequence |
MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPL
MVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAV QVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTIL QQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMV PGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLH ESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
| 1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [2] | |
| Coagulation factors | [+] 1 Coagulation factors Co-regulated By This TF | + | |||
| 1 | Coagulation factor VIII (F8) | Successful Target | Target Info | [3] | |
| Cytokines / Cytokine receptors | [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
| 1 | Apoptosis mediating surface antigen FAS (FAS) | Clinical trial Target | Target Info | [1] | |
| 2 | Interleukin-4 (IL4) | Clinical trial Target | Target Info | [4] | |
| Ester hydrolases | [+] 1 Ester hydrolases Co-regulated By This TF | + | |||
| 1 | M-phase inducer phosphatase 3 (MPIP3) | Literature-reported Target | Target Info | [5] | |
| Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
| 1 | Catalase (CAT) | Clinical trial Target | Target Info | [6] | |
| TF Name | Retinoid X receptor beta (RXR-B) | ||||
| Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
| Class | Cys4 zinc finger of nuclear receptor type | ||||
| Family | Thyroid hormone receptor-like factors | ||||
| Subfamily | Retinoid X receptors | ||||
| Regulation Type | Increase | ||||
| Regulation Mechanism | Various sequences in human FASpromoterI influence the binding of TR/RXRto TRE. | [1] | |||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Electrophoretic Mobility Shift Assay | [1] | |||
| UniProt ID | |||||
| Sequence |
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQT
PEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPP PPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVK PPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS CRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMP VDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHF SSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRV LTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYP EQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Cytokines / Cytokine receptors | [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
| 1 | Apoptosis mediating surface antigen FAS (FAS) | Clinical trial Target | Target Info | [1] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | Identification of thyroid hormone response elements in the human fatty acid synthase promoter. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12260-5. | ||||
| REF 2 | NFY transcription factor binds to regulatory element AIC and transactivates the human apolipoprotein A-I promoter in HEPG2 cells. Biochem Biophys Res Commun. 1997 Feb 3;231(1):140-3. | ||||
| REF 3 | Role of the liver-enriched transcription factor hepatocyte nuclear factor 1 in transcriptional regulation of the factor V111 gene. Mol Cell Biol. 1996 May;16(5):1936-45. | ||||
| REF 4 | Cloning of the cDNA encoding human C/EBP gamma, a protein binding to the PRE-I enhancer element of the human interleukin-4 promoter. Gene. 1995 Aug 19;161(2):271-5. | ||||
| REF 5 | Cell cycle regulation of cdc25C transcription is mediated by the periodic repression of the glutamine-rich activators NF-Y and Sp1. Nucleic Acids Res. 1995 Oct 11;23(19):3822-30. | ||||
| REF 6 | Regulation of the catalase gene promoter by Sp1, CCAAT-recognizing factors, and a WT1/Egr-related factor in hydrogen peroxide-resistant HP100 cells. Cancer Res. 2001 Aug 1;61(15):5885-94. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.