Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T19011
(Former ID: TTDR00208)
|
|||||
| Target Name |
M-phase inducer phosphatase 3 (MPIP3)
|
|||||
| Synonyms |
Dual specificity phosphatase Cdc25C; Cdc25C phosphatase
|
|||||
| Gene Name |
CDC25C
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| Function |
Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity. Functions as a dosage-dependent inducer in mitotic control.
Click to Show/Hide
|
|||||
| BioChemical Class |
Phosphoric monoester hydrolase
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 3.1.3.48
|
|||||
| Sequence |
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANL
SILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMK CSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNP NLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDK VKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQ DLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKK PIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| HIT2.0 ID | T42K6K | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | MX-7065 | Drug Info | Terminated | Solid tumour/cancer | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 4 Inhibitor drugs | + | ||||
| 1 | MX-7065 | Drug Info | [1] | |||
| 2 | BN-82002 | Drug Info | [3] | |||
| 3 | BN-82685 | Drug Info | [4] | |||
| 4 | NSC-663284 | Drug Info | [4] | |||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-regulating Transcription Factors | ||||||
| Target-interacting Proteins | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 4 KEGG Pathways | + | ||||
| 1 | Cell cycle | |||||
| 2 | Oocyte meiosis | |||||
| 3 | Progesterone-mediated oocyte maturation | |||||
| 4 | MicroRNAs in cancer | |||||
| Panther Pathway | [+] 1 Panther Pathways | + | ||||
| 1 | p53 pathway | |||||
| PID Pathway | [+] 4 PID Pathways | + | ||||
| 1 | ATR signaling pathway | |||||
| 2 | ATM pathway | |||||
| 3 | PLK1 signaling events | |||||
| 4 | PLK3 signaling events | |||||
| Reactome | [+] 6 Reactome Pathways | + | ||||
| 1 | Polo-like kinase mediated events | |||||
| 2 | Cyclin B2 mediated events | |||||
| 3 | Activation of ATR in response to replication stress | |||||
| 4 | RHO GTPases activate PKNs | |||||
| 5 | Cyclin A/B1 associated events during G2/M transition | |||||
| 6 | Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex | |||||
| WikiPathways | [+] 8 WikiPathways | + | ||||
| 1 | Monoamine Transport | |||||
| 2 | DNA Damage Response | |||||
| 3 | ATM Signaling Pathway | |||||
| 4 | Integrated Pancreatic Cancer Pathway | |||||
| 5 | Mitotic G2-G2/M phases | |||||
| 6 | Cell Cycle | |||||
| 7 | Cell Cycle Checkpoints | |||||
| 8 | miRNA Regulation of DNA Damage Response | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Handbook of Assay Development in Drug Discovery, Lisa K. Minor, 2013. Page(11). | |||||
| REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016615) | |||||
| REF 3 | Synthesis of small molecule CDC25 phosphatases inhibitors. Bioorg Med Chem Lett. 2004 Dec 6;14(23):5809-12. | |||||
| REF 4 | Synthesis and biological evaluation of novel heterocyclic quinones as inhibitors of the dual specificity protein phosphatase CDC25C. Bioorg Med Chem Lett. 2006 Jan 1;16(1):171-5. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.