Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T14597 | Target Info | |||
| Target Name | Erbb2 tyrosine kinase receptor (HER2) | ||||
| Synonyms | p185erbB2; Tyrosine kinase-type cell surface receptor HER2; Receptor tyrosine-protein kinase erbB-2; Proto-oncogene c-ErbB-2; Proto-oncogene Neu; NGL; NEU; Metastatic lymph node gene 19 protein; MLN19; MLN 19; HER2; CD340 | ||||
| Target Type | Successful Target | ||||
| Gene Name | ERBB2 | ||||
| Biochemical Class | Kinase | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | c-Myc proto-oncogene (MYC) | ||||
| Classification | Superclass | Basic Domains | |||
| Class | Helix-loop-helix / leucine zipper factors (bHLH-ZIP) | ||||
| Family | Cell-cycle controlling factors | ||||
| Subfamily | Myc | ||||
| Regulation Mechanism | The reversion was found to be a consequence of a transcription-repressive action of MYC on the ERBB2 gene via a 140-bp fragment on the neu gene promoter. | [1] | |||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Chloramphenicol Acetyltransferase Assay, Electrophoretic Mobility Shift Assay | [1] | |||
| UniProt ID | |||||
| Sequence |
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL RKRREQLKHKLEQLRNSCA |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Eukaryotic initiation factors | [+] 1 Eukaryotic initiation factors Co-regulated By This TF | + | |||
| 1 | Eukaryotic initiation factor 4E (EIF4E) | Literature-reported Target | Target Info | [2] | |
| G protein-coupled receptors | [+] 1 G protein-coupled receptors Co-regulated By This TF | + | |||
| 1 | C-X-C chemokine receptor type 4 (CXCR4) | Successful Target | Target Info | [3] | |
| Kinases | [+] 2 Kinases Co-regulated By This TF | + | |||
| 1 | Erbb2 tyrosine kinase receptor (HER2) | Successful Target | Target Info | [1] | |
| 2 | Telomerase reverse transcriptase (TERT) | Clinical trial Target | Target Info | [4] | |
| Lyases | [+] 1 Lyases Co-regulated By This TF | + | |||
| 1 | Ornithine decarboxylase (ODC1) | Successful Target | Target Info | [5] | |
| Transcription factors | [+] 1 Transcription factors Co-regulated By This TF | + | |||
| 1 | Transcription factor E2F2 (E2F2) | Literature-reported Target | Target Info | [6] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | c-myc reverses neu-induced transformed morphology by transcriptional repression. Mol Cell Biol. 1991 Jan;11(1):354-62. | ||||
| REF 2 | An essential E box in the promoter of the gene encoding the mRNA cap-binding protein (eukaryotic initiation factor 4E) is a target for activation by c-myc. Mol Cell Biol. 1996 Sep;16(9):4754-64. | ||||
| REF 3 | USF/c-Myc enhances, while Yin-Yang 1 suppresses, the promoter activity of CXCR4, a coreceptor for HIV-1 entry. J Immunol. 1999 May 15;162(10):5986-92. | ||||
| REF 4 | Sp1 cooperates with c-Myc to activate transcription of the human telomerase reverse transcriptase gene (hTERT). Nucleic Acids Res. 2000 Feb 1;28(3):669-77. | ||||
| REF 5 | The ornithine decarboxylase gene is a transcriptional target of c-Myc. Proc Natl Acad Sci U S A. 1993 Aug 15;90(16):7804-8. | ||||
| REF 6 | Identification of positively and negatively acting elements regulating expression of the E2F2 gene in response to cell growth signals. Mol Cell Biol. 1997 Sep;17(9):5227-35. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.