Target Regulator(s) Information (Transcription Factor)
Target General Information | Top | ||||
---|---|---|---|---|---|
Target ID | T16180 | Target Info | |||
Target Name | Transcription factor E2F2 (E2F2) | ||||
Synonyms | E2F-2 | ||||
Target Type | Literature-reported Target | ||||
Gene Name | E2F2 | ||||
UniProt ID |
The Transcription Factors (TFs) Regulating This Target | Top | ||||
---|---|---|---|---|---|
TF Name | c-Myc proto-oncogene (MYC) | ||||
Classification | Superclass | Basic Domains | |||
Class | Helix-loop-helix / leucine zipper factors (bHLH-ZIP) | ||||
Family | Cell-cycle controlling factors | ||||
Subfamily | Myc | ||||
Regulation Mechanism | Sequence comparison reveals the presence of a variety of known transcription factor binding sites, including E-box elements that are consensus MYC binding sites, as well as E2F binding sites. The E-box elements, which we show can function as MYC-responsive sites, contribute in a positive fashion to promoter function. | [1] | |||
Evidence Score (E-score) | 2 | + | |||
UniProt ID | |||||
Sequence |
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL RKRREQLKHKLEQLRNSCA |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Eukaryotic initiation factors | [+] 1 Eukaryotic initiation factors Co-regulated By This TF | + | |||
G protein-coupled receptors | [+] 1 G protein-coupled receptors Co-regulated By This TF | + | |||
Kinases | [+] 2 Kinases Co-regulated By This TF | + | |||
Lyases | [+] 1 Lyases Co-regulated By This TF | + | |||
Transcription factors | [+] 1 Transcription factors Co-regulated By This TF | + | |||
TF Name | E2F transcription factor homodimer | ||||
Classification | Superclass | Helix-turn-helix | |||
Class | Fork head / winged helix | ||||
Regulation Mechanism | Sequence comparison reveals the presence of a variety of known transcription factor binding sites, including E-box elements that are consensus MYC binding sites, as well as E2F binding sites. The E-box elements, which we show can function as MYC-responsive sites, contribute in a positive fashion to promoter function. | [1] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCD
PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK SPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI AKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDS QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPE ETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLS RMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG IRDLFDCDFGDLTPLDF |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Caveolin proteins | [+] 1 Caveolin proteins Co-regulated By This TF | + | |||
Kinases | [+] 1 Kinases Co-regulated By This TF | + | |||
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
Transcription factors | [+] 1 Transcription factors Co-regulated By This TF | + |
References | Top | ||||
---|---|---|---|---|---|
REF 1 | Identification of positively and negatively acting elements regulating expression of the E2F2 gene in response to cell growth signals. Mol Cell Biol. 1997 Sep;17(9):5227-35. | ||||
REF 2 | miR-31 promotes proliferation of colon cancer cells by targeting E2F2. Biotechnol Lett. 2015 Mar;37(3):523-32. | ||||
REF 3 | An essential E box in the promoter of the gene encoding the mRNA cap-binding protein (eukaryotic initiation factor 4E) is a target for activation by c-myc. Mol Cell Biol. 1996 Sep;16(9):4754-64. | ||||
REF 4 | USF/c-Myc enhances, while Yin-Yang 1 suppresses, the promoter activity of CXCR4, a coreceptor for HIV-1 entry. J Immunol. 1999 May 15;162(10):5986-92. | ||||
REF 5 | c-myc reverses neu-induced transformed morphology by transcriptional repression. Mol Cell Biol. 1991 Jan;11(1):354-62. | ||||
REF 6 | Sp1 cooperates with c-Myc to activate transcription of the human telomerase reverse transcriptase gene (hTERT). Nucleic Acids Res. 2000 Feb 1;28(3):669-77. | ||||
REF 7 | The ornithine decarboxylase gene is a transcriptional target of c-Myc. Proc Natl Acad Sci U S A. 1993 Aug 15;90(16):7804-8. | ||||
REF 8 | Intracellular cholesterol transport in synchronized human skin fibroblasts. Biochemistry. 1999 Feb 23;38(8):2506-13. | ||||
REF 9 | Constitutive protection of E2F recognition sequences in the human thymidine kinase promoter during cell cycle progression. J Biol Chem. 1997 Nov 28;272(48):30483-90. | ||||
REF 10 | An inverted repeat motif stabilizes binding of E2F and enhances transcription of the dihydrofolate reductase gene. J Biol Chem. 1995 Apr 28;270(17):9783-91. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.