Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T22118 | Target Info | |||
| Target Name | Dopamine D1 receptor (D1R) | ||||
| Synonyms | D(1A) dopamine receptor | ||||
| Target Type | Successful Target | ||||
| Gene Name | DRD1 | ||||
| Biochemical Class | GPCR rhodopsin | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | Homeobox protein Meis2 (MEIS2) | ||||
| Classification | Superclass | Helix-turn-helix | |||
| Class | Homeo domain | ||||
| Regulation Mechanism | Among the five cloned splice variants of MEIS2, isoforms MEIS2-d activate the DRD1 promoter in most cell types tested. | [1] | |||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Electrophoretic Mobility Shift Assay | [1] | |||
| UniProt ID | |||||
| Sequence |
MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNV
MPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFN EDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLK GKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGH ASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLT HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYS PEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLR HGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| G protein-coupled receptors | [+] 1 G protein-coupled receptors Co-regulated By This TF | + | |||
| 1 | Dopamine D1 receptor (D1R) | Successful Target | Target Info | [1] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | Three-amino acid extension loop homeodomain proteins Meis2 and TGIF differentially regulate transcription. J Biol Chem. 2000 Jul 7;275(27):20734-41. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.