Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T22118
(Former ID: TTDS00011)
|
|||||
Target Name |
Dopamine D1 receptor (D1R)
|
|||||
Synonyms |
D(1A) dopamine receptor
Click to Show/Hide
|
|||||
Gene Name |
DRD1
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 4 Target-related Diseases | + | ||||
1 | Abortion [ICD-11: JA00] | |||||
2 | Allergic/hypersensitivity disorder [ICD-11: 4A80-4A8Z] | |||||
3 | Hypertension [ICD-11: BA00-BA04] | |||||
4 | Parkinsonism [ICD-11: 8A00] | |||||
Function |
Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL SVILDYDTDVSLEKIQPITQNGQHPT Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
ADReCS ID | BADD_A00129 ; BADD_A01381 ; BADD_A03311 ; BADD_A04234 ; BADD_A05088 | |||||
HIT2.0 ID | T28IL8 |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 4 Approved Drugs | + | ||||
1 | Fenoldopam | Drug Info | Approved | Hypertension | [2], [3] | |
2 | Methylergonovine | Drug Info | Approved | Spontaneous abortion | [4] | |
3 | Pergolide | Drug Info | Approved | Parkinson disease | [5], [6] | |
4 | Phenyltoloxamine | Drug Info | Approved | Allergy | [4] | |
Clinical Trial Drug(s) | [+] 5 Clinical Trial Drugs | + | ||||
1 | Ecopipam | Drug Info | Phase 3 | Cocaine addiction | [7], [8] | |
2 | Zicronapine | Drug Info | Phase 3 | Schizophrenia | [9] | |
3 | DAS-431 | Drug Info | Phase 2 | Dementia | [10] | |
4 | Dihydrexidine | Drug Info | Phase 1/2 | Psychotic disorder | [11] | |
5 | Lu AF28996 | Drug Info | Phase 1 | Parkinson disease | [12] | |
Discontinued Drug(s) | [+] 19 Discontinued Drugs | + | ||||
1 | ADROGOLIDE HYDROCHLORIDE | Drug Info | Discontinued in Phase 2 | Cognitive impairment | [13] | |
2 | ADX-10061 | Drug Info | Discontinued in Phase 2 | Psychotic disorder | [14] | |
3 | BAM-1110 | Drug Info | Discontinued in Phase 2 | Parkinson disease | [15] | |
4 | CY-208243 | Drug Info | Discontinued in Phase 2 | Pain | [16] | |
5 | ZELANDOPAM HYDROCHLORIDE | Drug Info | Discontinued in Phase 2 | Hypertension | [17] | |
6 | Berupipam | Drug Info | Discontinued in Phase 1 | Psychotic disorder | [18] | |
7 | BTS-73947 | Drug Info | Discontinued in Phase 1 | Psychotic disorder | [19] | |
8 | Odapipam | Drug Info | Discontinued in Phase 1 | Psychotic disorder | [20] | |
9 | SDZ-GLC-756 | Drug Info | Discontinued in Phase 1 | Glaucoma/ocular hypertension | [21] | |
10 | A 77636 | Drug Info | Terminated | Parkinson disease | [23] | |
11 | A-68930 | Drug Info | Terminated | Hypertension | [24], [25] | |
12 | A-69024 | Drug Info | Terminated | Psychotic disorder | [26] | |
13 | BIMG80 | Drug Info | Terminated | Psychotic disorder | [27] | |
14 | CEE-03-320 | Drug Info | Terminated | Substance use disorder | [28] | |
15 | NNC-22-0031 | Drug Info | Terminated | Psychotic disorder | [29] | |
16 | Org-10490 | Drug Info | Terminated | Psychotic disorder | [30] | |
17 | SDZ-PSD-958 | Drug Info | Terminated | Psychiatric disorder | [31] | |
18 | SKF 38393 | Drug Info | Terminated | Type-2 diabetes | [32], [33] | |
19 | SKF-81297 | Drug Info | Terminated | Parkinson disease | [34], [35] | |
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | BSF-78438 | Drug Info | Preclinical | Schizophrenia | [22] | |
Mode of Action | [+] 6 Modes of Action | + | ||||
Agonist | [+] 8 Agonist drugs | + | ||||
1 | Fenoldopam | Drug Info | [1] | |||
2 | DAS-431 | Drug Info | [41] | |||
3 | ADROGOLIDE HYDROCHLORIDE | Drug Info | [4], [41] | |||
4 | CY-208243 | Drug Info | [46], [47] | |||
5 | (+)-ADTN | Drug Info | [62] | |||
6 | N-propylnorapomorphine | Drug Info | [62] | |||
7 | SKF-75670 | Drug Info | [97] | |||
8 | SKF-83959 | Drug Info | [98] | |||
Antagonist | [+] 9 Antagonist drugs | + | ||||
1 | Methylergonovine | Drug Info | [36] | |||
2 | ADX-10061 | Drug Info | [44] | |||
3 | ZELANDOPAM HYDROCHLORIDE | Drug Info | [4], [48] | |||
4 | Berupipam | Drug Info | [49] | |||
5 | BTS-73947 | Drug Info | [4], [50] | |||
6 | Odapipam | Drug Info | [51] | |||
7 | SCH-23390 | Drug Info | [94] | |||
8 | SKF-83556 | Drug Info | [62] | |||
9 | [125I]SCH23982 | Drug Info | [101] | |||
Modulator | [+] 15 Modulator drugs | + | ||||
1 | Pergolide | Drug Info | [37] | |||
2 | Ecopipam | Drug Info | [39] | |||
3 | Zicronapine | Drug Info | [40] | |||
4 | BAM-1110 | Drug Info | [45] | |||
5 | SDZ-GLC-756 | Drug Info | [52] | |||
6 | A 77636 | Drug Info | [53] | |||
7 | A-68930 | Drug Info | [54], [55] | |||
8 | A-69024 | Drug Info | [56] | |||
9 | BIMG80 | Drug Info | [57] | |||
10 | CEE-03-320 | Drug Info | [58] | |||
11 | NNC-22-0031 | Drug Info | [29] | |||
12 | Org-10490 | Drug Info | [37] | |||
13 | SDZ-PSD-958 | Drug Info | [59] | |||
14 | SKF 38393 | Drug Info | [33] | |||
15 | SKF-81297 | Drug Info | [60] | |||
Inhibitor | [+] 79 Inhibitor drugs | + | ||||
1 | Phenyltoloxamine | Drug Info | [38] | |||
2 | Dihydrexidine | Drug Info | [42] | |||
3 | (+)-(1R,1'S)-berbamunine hydrochloride | Drug Info | [61] | |||
4 | (+)-(1R,1'S)-thaligrisine hydrochloride | Drug Info | [61] | |||
5 | (+)-BUTACLAMOL | Drug Info | [63] | |||
6 | (+/-)-nantenine | Drug Info | [64] | |||
7 | (-)-(1S,1'R)-O,O-dimethylgrisbine hydrochloride | Drug Info | [61] | |||
8 | (R)-(+)-coclaurine | Drug Info | [65] | |||
9 | (R)-(-)-10-methyl-11-hydroxyaporphine | Drug Info | [66] | |||
10 | (R)-(-)-11-hydroxy-N-n-propylnoraporphine | Drug Info | [67] | |||
11 | (R)-(-)-2-methoxy-11-hydroxyaporphine | Drug Info | [67] | |||
12 | (R)-(-)-2-methoxy-N-npropylnorapomorphine | Drug Info | [67] | |||
13 | (R)-(-)-N-ethyl-2-methoxy-11-hydroxynoraporphine | Drug Info | [67] | |||
14 | (R)-(-)-N-propyl-2-methoxy-11-hydroxynoraporphine | Drug Info | [67] | |||
15 | (R)-11-Amino-2-methoxyaporphine | Drug Info | [68] | |||
16 | (R)-2,11-Diaminoaporphine | Drug Info | [68] | |||
17 | (R,S)-homoaromaline hydrochloride | Drug Info | [61] | |||
18 | (S)-BULBOCAPNINE | Drug Info | [69] | |||
19 | (S)APOMORPHINE | Drug Info | [70] | |||
20 | (S,S)-oxandrine hydrochloride | Drug Info | [61] | |||
21 | 1,2,3,7,12,12a-hexahydro-1-aza-pleiaden-5-ol | Drug Info | [69] | |||
22 | 1,2,3,7,12,12a-hexahydro-1-aza-pleiadene-5,6-diol | Drug Info | [69] | |||
23 | 1,2-Bis-[R-(-)-apomorphine-2'-oxy]ethane | Drug Info | [71] | |||
24 | 1-(4-(1H-pyrazol-1-yl)benzyl)-4-phenylpiperazine | Drug Info | [72] | |||
25 | 1-Aminomethyl-3-cyclohexyl-isochroman-5,6-diol | Drug Info | [73] | |||
26 | 1-Aminomethyl-3-phenyl-isochroman-5,6-diol | Drug Info | [55] | |||
27 | 1-Aminomethyl-isochroman-5,6-diol | Drug Info | [55] | |||
28 | 1-Benzyl-4-(2-ethynyl-pyrrol-1-yl)-piperidine | Drug Info | [74] | |||
29 | 1-Benzyl-4-(2-iodo-pyrrol-1-yl)-piperidine | Drug Info | [74] | |||
30 | 1-Benzyl-4-(2-oxazol-5-yl-pyrrol-1-yl)-piperidine | Drug Info | [74] | |||
31 | 1-Dibenzo[b,f]oxepin-10-yl-4-methyl-piperazine | Drug Info | [75] | |||
32 | 1-[2-(2-Benzyl-phenoxy)-ethyl]-piperidine | Drug Info | [38] | |||
33 | 1-[2-(2-Benzyl-phenoxy)-ethyl]-pyrrolidine | Drug Info | [38] | |||
34 | 1-[3-(2-Benzyl-phenoxy)-propyl]-pyrrolidine | Drug Info | [38] | |||
35 | 11-Butyryloxy-N-n-propylnoraporphine | Drug Info | [76] | |||
36 | 11-Heptanoyloxy-N-n-propylnoraporphine | Drug Info | [76] | |||
37 | 11-Hexanoyloxy-N-n-propylnoraporphine | Drug Info | [76] | |||
38 | 11-Propionyloxy-N-n-propylnoraporphine | Drug Info | [76] | |||
39 | 11-valeryloxynoraporphine | Drug Info | [76] | |||
40 | 2-methoxyapomorphine | Drug Info | [71] | |||
41 | 2-Methyl-8-phenyl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [77] | |||
42 | 2-{[R-(-)-Apomorphine-2'-oxy]ethoxy}-ethanol | Drug Info | [71] | |||
43 | 3,8-dibromoboldine | Drug Info | [78] | |||
44 | 3-bromoboldine | Drug Info | [78] | |||
45 | 3-Chloroboldine | Drug Info | [78] | |||
46 | 3-Iodoboldine | Drug Info | [78] | |||
47 | 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [79] | |||
48 | 4-[2-(2-Benzyl-phenoxy)-ethyl]-morpholine | Drug Info | [38] | |||
49 | 5-(2-Amino-ethyl)-2-chloro-phenol hydrobromide | Drug Info | [80] | |||
50 | 6-(2-Amino-ethyl)-biphenyl-2,3,4'-triol | Drug Info | [81] | |||
51 | 6-(2-Amino-ethyl)-biphenyl-2,3-diol | Drug Info | [81] | |||
52 | 6-(2-Dipropylamino-ethyl)-biphenyl-2,3,4'-triol | Drug Info | [81] | |||
53 | 6-(2-Dipropylamino-ethyl)-biphenyl-2,3-diol | Drug Info | [81] | |||
54 | 9-Aminomethyl-9H-fluorene-2,5,6-triol | Drug Info | [81] | |||
55 | 9-Aminomethyl-9H-fluorene-3,4-diol | Drug Info | [81] | |||
56 | BOLDINE | Drug Info | [78] | |||
57 | Etoloxamine | Drug Info | [38] | |||
58 | FALCARINDIOL | Drug Info | [82] | |||
59 | FLUMEZAPINE | Drug Info | [83] | |||
60 | FLUTROLINE | Drug Info | [84] | |||
61 | GLAUCINE | Drug Info | [69] | |||
62 | IBZM | Drug Info | [85] | |||
63 | ISOCLOZAPINE | Drug Info | [86] | |||
64 | ISOLOXAPINE | Drug Info | [87] | |||
65 | MCL-516 | Drug Info | [88] | |||
66 | MELOSMINE | Drug Info | [69] | |||
67 | N-(4-Dipropylaminobutyl)-4-biphenylcarboxamide | Drug Info | [89] | |||
68 | N-(4-Propylaminobutyl)-4-biphenylcarboxamide | Drug Info | [89] | |||
69 | NORSTEPHALAGINE | Drug Info | [69] | |||
70 | PUKATEINE | Drug Info | [69] | |||
71 | QUINPIROLE | Drug Info | [90] | |||
72 | Ro-21-7767 | Drug Info | [91] | |||
73 | SB-271046 | Drug Info | [92] | |||
74 | SCH-12679 | Drug Info | [93] | |||
75 | SCH-24518 | Drug Info | [95] | |||
76 | SK&F-89626 | Drug Info | [96] | |||
77 | STEPHOLIDINE | Drug Info | [99] | |||
78 | TEPA (possesses cytotoxic activity) | Drug Info | [100] | |||
79 | [R-(-)-Apomorphine-2-yl]-(2'-hydroxy-ethyl)ether | Drug Info | [71] | |||
Stimulator | [+] 1 Stimulator drugs | + | ||||
1 | Lu AF28996 | Drug Info | [43] | |||
Binder | [+] 1 Binder drugs | + | ||||
1 | BSF-78438 | Drug Info | [22] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Drug Binding Sites of Target | Top | |||||
---|---|---|---|---|---|---|
Ligand Name: Dopamine | Ligand Info | |||||
Structure Description | Cryo-EM structure of the dopamine and LY3154207-bound D1 dopamine receptor and mini-Gs complex | PDB:7X2F | ||||
Method | Electron microscopy | Resolution | 3.00 Å | Mutation | Yes | [102] |
PDB Sequence |
SVRILTACFL
30 SLLILSTLLG40 NTLVCAAVIR50 FRHLRSKVTN60 FFVISLAVSD70 LLVAVLVMPW 80 KAVAEIAGFW90 PFGSFCNIWV100 AFDIMCSTAS110 ILNLCVISVD120 RYWAISSPFR 130 YERKMTPKAA140 FILISVAWTL150 SVLISFIPVQ160 LSWHKAKDNC186 DSSLSRTYAI 196 SSSVISFYIP206 VAIMIVTYTR216 IYRIAQKQIR226 RIAALERAAV236 HAKNCFKRET 268 KVLKTLSVIM278 GVFVCCWLPF288 FILNCILPFC298 GFCIDSNTFD314 VFVWFGWANS 324 SLNPIIYAFN334 ADFRKAFSTL344 LG
|
|||||
|
||||||
Click to View More Binding Site Information of This Target and Ligand Pair | ||||||
Ligand Name: Apomorphine | Ligand Info | |||||
Structure Description | Cryo-EM structure of apomorphine-bound dopamine receptor 1 in complex with Gs protein | PDB:7JVQ | ||||
Method | Electron microscopy | Resolution | 3.00 Å | Mutation | No | [103] |
PDB Sequence |
SVRILTACFL
30 SLLILSTLLG40 NTLVCAAVIR50 FRHLRSKVTN60 FFVISLAVSD70 LLVAVLVMPW 80 KAVAEIAGFW90 PFGSFCNIWV100 AFDIMCSTAS110 ILNLCVISVD120 RYWAISSPFR 130 YERKMTPKAA140 FILISVAWTL150 SVLISFIPVQ160 LSWHKAKPID184 NCDSSLSRTY 194 AISSSVISFY204 IPVAIMIVTY214 TRIYRIAQKQ224 IRRIAALERA234 AVHAKNCQFK 265 RETKVLKTLS275 VIMGVFVCCW285 LPFFILNCIL295 PFCFCIDSNT312 FDVFVWFGWA 322 NSSLNPIIYA332 FNADFRKAFS342 TLLGCY
|
|||||
|
||||||
Click to View More Binding Site Information of This Target with Different Ligands |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Pathway Affiliation
Biological Network Descriptors
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
Calcium signaling pathway | hsa04020 | Affiliated Target |
|
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
cAMP signaling pathway | hsa04024 | Affiliated Target |
|
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Neuroactive ligand-receptor interaction | hsa04080 | Affiliated Target |
|
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy | ||
Gap junction | hsa04540 | Affiliated Target |
|
Class: Cellular Processes => Cellular community - eukaryotes | Pathway Hierarchy | ||
Dopaminergic synapse | hsa04728 | Affiliated Target |
|
Class: Organismal Systems => Nervous system | Pathway Hierarchy |
Degree | 2 | Degree centrality | 2.15E-04 | Betweenness centrality | 0.00E+00 |
---|---|---|---|---|---|
Closeness centrality | 1.73E-01 | Radiality | 1.28E+01 | Clustering coefficient | 1.00E+00 |
Neighborhood connectivity | 2.25E+01 | Topological coefficient | 6.82E-01 | Eccentricity | 13 |
Download | Click to Download the Full PPI Network of This Target | ||||
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-regulating Transcription Factors |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 10 KEGG Pathways | + | ||||
1 | Calcium signaling pathway | |||||
2 | cAMP signaling pathway | |||||
3 | Neuroactive ligand-receptor interaction | |||||
4 | Gap junction | |||||
5 | Dopaminergic synapse | |||||
6 | Parkinson's disease | |||||
7 | Cocaine addiction | |||||
8 | Amphetamine addiction | |||||
9 | Morphine addiction | |||||
10 | Alcoholism | |||||
Panther Pathway | [+] 1 Panther Pathways | + | ||||
1 | Dopamine receptor mediated signaling pathway | |||||
Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | ||||
1 | Dopamine Activation of Neurological Reward System | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Dopamine receptors | |||||
2 | G alpha (s) signalling events | |||||
WikiPathways | [+] 6 WikiPathways | + | ||||
1 | Hypothetical Network for Drug Addiction | |||||
2 | Monoamine GPCRs | |||||
3 | GPCRs, Class A Rhodopsin-like | |||||
4 | Genes and (Common) Pathways Underlying Drug Addiction | |||||
5 | GPCR ligand binding | |||||
6 | GPCR downstream signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Etiology of iodinated radiocontrast nephrotoxicity and its attenuation by beraprost. Yakugaku Zasshi. 2008 Jul;128(7):1023-9. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 985). | |||||
REF 3 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | |||||
REF 4 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 48). | |||||
REF 6 | Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54. | |||||
REF 7 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3304). | |||||
REF 8 | ClinicalTrials.gov (NCT01751802) Ecopipam Treatment of Self-Injurious Behavior in Subjects With Lesch-Nyhan Disease. U.S. National Institutes of Health. | |||||
REF 9 | ClinicalTrials.gov (NCT01295372) Safety and Efficacy of Zicronapine in Patients With Schizophrenia. U.S. National Institutes of Health. | |||||
REF 10 | The SAGE Handbook of Healthcare, Decision Resources Inc. Page(548). | |||||
REF 11 | Effects of the D1 dopamine receptor agonist dihydrexidine (DAR-0100A) on working memory in schizotypal personality disorder. Neuropsychopharmacology. 2015 Jan;40(2):446-53. | |||||
REF 12 | ClinicalTrials.gov (NCT04291859) Interventional, Open-label, Exploratory Study, Investigating the Safety, Tolerability, Pharmacokinetics, and Efficacy of Lu AF28996 in Patients With Parkinson's Disease. U.S.National Institutes of Health. | |||||
REF 13 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006590) | |||||
REF 14 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001476) | |||||
REF 15 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005232) | |||||
REF 16 | Decrease of behavioral and biochemical denervation supersensitivity of rat striatum by nigral transplants. Neuroscience. 1991;44(1):75-83. | |||||
REF 17 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002584) | |||||
REF 18 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004006) | |||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008043) | |||||
REF 20 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006052) | |||||
REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008736) | |||||
REF 22 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. | |||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002413) | |||||
REF 24 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6077). | |||||
REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002423) | |||||
REF 26 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002637) | |||||
REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006596) | |||||
REF 28 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007189) | |||||
REF 29 | NNC-19-1228 and NNC 22-0031, novel neuroleptics with a "mesolimbic-selective" behavioral profile. Psychopharmacology (Berl). 1997 Jan;129(2):168-78. | |||||
REF 30 | ORG 10490: A new antipsychotic drug with 5-HT2 and DA antagonistic properties. ScienceDirect, Volume 6, Issue 2, January 1992, Pages 111. | |||||
REF 31 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009027) | |||||
REF 32 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 935). | |||||
REF 33 | The D1 dopamine receptor agonist SKF-38393 stimulates the release of glutamate in the hippocampus. Neuroscience. 1999;94(4):1063-70. | |||||
REF 34 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 938). | |||||
REF 35 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004119) | |||||
REF 36 | Reinforcement in an in vitro analog of appetitive classical conditioning of feeding behavior in Aplysia: blockade by a dopamine antagonist. Learn Mem. 2005 May-Jun;12(3):216-20. | |||||
REF 37 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
REF 38 | Dopamine/serotonin receptor ligands. 9. Oxygen-containing midsized heterocyclic ring systems and nonrigidized analogues. A step toward dopamine D5 ... J Med Chem. 2004 Aug 12;47(17):4155-8. | |||||
REF 39 | A D1 receptor antagonist, ecopipam, for treatment of tics in Tourette syndrome.Clin Neuropharmacol.2014 Jan-Feb;37(1):26-30. | |||||
REF 40 | Clinical pipeline report, company report or official report of Lundbeck. | |||||
REF 41 | Adrogolide HCl (ABT-431; DAS-431), a prodrug of the dopamine D1 receptor agonist, A-86929: preclinical pharmacology and clinical data. CNS Drug Rev. 2001 Fall;7(3):305-16. | |||||
REF 42 | trans-2,3-dihydroxy-6a,7,8,12b-tetrahydro-6H-chromeno[3,4-c]isoquinoline: synthesis, resolution, and preliminary pharmacological characterization o... J Med Chem. 2006 Nov 16;49(23):6848-57. | |||||
REF 43 | Clinical pipeline report, company report or official report of Lundbeck | |||||
REF 44 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001476) | |||||
REF 45 | Therapeutic effects of dopamine D1/D2 receptor agonists on detrusor hyperreflexia in 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine-lesioned parkinso... J Pharmacol Exp Ther. 1998 Jul;286(1):228-33. | |||||
REF 46 | The D-1 dopamine receptor partial agonist, CY 208-243, exhibits antiparkinsonian activity in the MPTP-treated marmoset. Eur J Pharmacol. 1988 Nov 1;156(2):197-206. | |||||
REF 47 | Dopamine D1 receptor agonists induce penile erections in rats. Eur J Pharmacol. 2003 Jan 26;460(1):71-4. | |||||
REF 48 | Effect of zelandopam, a dopamine D1-like receptor agonist, in puromycin aminonucleoside nephrosis rats. Eur J Pharmacol. 2005 Mar 7;510(1-2):121-6. | |||||
REF 49 | Characterization of benzazepine UDP-glucuronosyl-transferases in laboratory animals and man. Xenobiotica. 1995 Jun;25(6):611-22. | |||||
REF 50 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008043) | |||||
REF 51 | PET studies of binding competition between endogenous dopamine and the D1 radiotracer [11C]NNC 756. Synapse. 1999 May;32(2):93-109. | |||||
REF 52 | SDZ GLC 756, a novel octahydrobenzo[g]quinoline derivative exerts opposing effects on dopamine D1 and D2 receptors. J Neural Transm. 1996;103(1-2):17-30. | |||||
REF 53 | Actions of the D1 agonists A-77636 and A-86929 on locomotion and dyskinesia in MPTP-treated L-dopa-primed common marmosets. Psychopharmacology (Berl). 1999 Feb;142(1):51-60. | |||||
REF 54 | Comparison of the D1-dopamine agonists SKF-38393 and A-68930 in neonatal 6-hydroxydopamine-lesioned rats: behavioral effects and induction of c-fos-like immunoreactivity. J Pharmacol Exp Ther. 1992 Aug;262(2):855-65. | |||||
REF 55 | (1R,3S)-1-(aminomethyl)-3,4-dihydro-5,6-dihydroxy-3-phenyl-1H-2-benzopyran: a potent and selective D1 agonist. J Med Chem. 1990 Nov;33(11):2948-50. | |||||
REF 56 | (+)-[76Br]A-69024: a non-benzazepine radioligand for studies of dopamine D1 receptors using PET. Nucl Med Biol. 2002 Apr;29(3):295-302. | |||||
REF 57 | BIMG 80, a novel potential antipsychotic drug: evidence for multireceptor actions and preferential release of dopamine in prefrontal cortex. J Neurochem. 1997 Jul;69(1):182-90. | |||||
REF 58 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007189) | |||||
REF 59 | SDZ PSD 958, a novel D1 receptor antagonist with potential limbic selectivity. J Neural Transm. 1996;103(3):261-76. | |||||
REF 60 | Dopamine D1 receptor involvement in the discriminative-stimulus effects of SKF 81297 in squirrel monkeys. J Pharmacol Exp Ther. 1993 Nov;267(2):765-75. | |||||
REF 61 | Displacement activity of bisbenzylisoquinoline alkaloids at striatal 3H-SCH 23390 and 3H-raclopride binding sites. J Nat Prod. 1992 Sep;55(9):1281-6. | |||||
REF 62 | Cloning of the gene for a human dopamine D5 receptor with higher affinity for dopamine than D1. Nature. 1991 Apr 18;350(6319):614-9. | |||||
REF 63 | 7-Methyl-6,7,8,9,14,15-hexahydro-5H-benz[d]indolo[2,3-g]azecine: a new heterocyclic system and a new lead compound for dopamine receptor antagonists. J Med Chem. 2000 May 18;43(10):2079-81. | |||||
REF 64 | Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. | |||||
REF 65 | Synthesis and dopamine receptor selectivity of the benzyltetrahydroisoquinoline, (R)-(+)-nor-roefractine. J Nat Prod. 1998 Jun 26;61(6):709-12. | |||||
REF 66 | R-(-)-N-alkyl-11-hydroxy-10-hydroxymethyl- and 10-methyl-aporphines as 5-HT1A receptor ligands. Bioorg Med Chem Lett. 2007 Aug 1;17(15):4128-30. | |||||
REF 67 | Synthesis and dopamine receptor affinities of N-alkyl-11-hydroxy-2-methoxynoraporphines: N-alkyl substituents determine D1 versus D2 receptor selec... J Med Chem. 2008 Feb 28;51(4):983-7. | |||||
REF 68 | Synthesis and pharmacological investigation of novel 2-aminothiazole-privileged aporphines. Bioorg Med Chem. 2008 Jul 15;16(14):6675-81. | |||||
REF 69 | Advances in development of dopaminergic aporphinoids. J Med Chem. 2007 Jan 25;50(2):171-81. | |||||
REF 70 | Synthesis and dopamine receptor affinities of enantiomers of 2-substituted apomorphines and their N-n-propyl analogues. J Med Chem. 1990 Jun;33(6):1800-5. | |||||
REF 71 | Synthesis and neuropharmacological characterization of 2-O-substituted apomorphines. Bioorg Med Chem. 2008 Apr 15;16(8):4563-8. | |||||
REF 72 | Synthesis and biological investigations of dopaminergic partial agonists preferentially recognizing the D4 receptor subtype. Bioorg Med Chem Lett. 2006 Jun 1;16(11):2955-9. | |||||
REF 73 | Synthesis and pharmacological evaluation of 1-(aminomethyl)-3,4-dihydro-5-hydroxy-1H-2-benzopyrans as dopamine D1 selective ligands. J Med Chem. 1991 Oct;34(10):2946-53. | |||||
REF 74 | Piperidinylpyrroles: design, synthesis and binding properties of novel and selective dopamine D4 receptor ligands. Bioorg Med Chem Lett. 1999 Nov 1;9(21):3143-6. | |||||
REF 75 | Affinity of 10-(4-methylpiperazino)dibenz[b,f]oxepins for clozapine and spiroperidol binding sites in rat brain. J Med Chem. 1982 Jul;25(7):855-8. | |||||
REF 76 | N-Propylnoraporphin-11-O-yl carboxylic esters as potent dopamine D(2) and serotonin 5-HT(1A) receptor dual ligands. Bioorg Med Chem. 2008 Sep 15;16(18):8335-8. | |||||
REF 77 | Synthesis and evaluation of 1,2,3,4-tetrahydro[1]benzothieno[2,3-h]isoquinolines as dopamine antagonists. J Med Chem. 1981 Sep;24(9):1107-10. | |||||
REF 78 | Halogenated boldine derivatives with enhanced monoamine receptor selectivity. J Nat Prod. 2000 Apr;63(4):480-4. | |||||
REF 79 | Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97. | |||||
REF 80 | Synthesis and pharmacological characterization of 2-(4-chloro-3-hydroxyphenyl)ethylamine and N,N-dialkyl derivatives as dopamine receptor ligands. J Med Chem. 1992 Nov 13;35(23):4408-14. | |||||
REF 81 | Synthesis and dopaminergic binding of 2-aryldopamine analogues: phenethylamines, 3-benzazepines, and 9-(aminomethyl)fluorenes. J Med Chem. 1986 Oct;29(10):1904-12. | |||||
REF 82 | Novel coumarin glycoside and phenethyl vanillate from Notopterygium forbesii and their binding affinities for opioid and dopamine receptors. Bioorg Med Chem. 2008 Mar 15;16(6):3218-23. | |||||
REF 83 | Effects of conformationally restricted 4-piperazinyl-10H-thienobenzodiazepine neuroleptics on central dopaminergic and cholinergic systems. J Med Chem. 1982 Oct;25(10):1133-40. | |||||
REF 84 | Neuroleptic activity in 5-aryltetrahydro-gamma-carbolines. J Med Chem. 1980 Jun;23(6):635-43. | |||||
REF 85 | In vitro affinities of various halogenated benzamide derivatives as potential radioligands for non-invasive quantification of D(2)-like dopamine re... Bioorg Med Chem. 2007 Nov 1;15(21):6819-29. | |||||
REF 86 | Synthesis and pharmacological evaluation of triflate-substituted analogues of clozapine: identification of a novel atypical neuroleptic. J Med Chem. 1997 Dec 5;40(25):4146-53. | |||||
REF 87 | Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain. J Med Chem. 1981 Sep;24(9):1021-6. | |||||
REF 88 | Synthesis and neuropharmacological evaluation of esters of R(-)-N-alkyl-11-hydroxy-2-methoxynoraporphines. Bioorg Med Chem Lett. 2009 Jan 1;19(1):51-3. | |||||
REF 89 | Novel D3 selective dopaminergics incorporating enyne units as nonaromatic catechol bioisosteres: synthesis, bioactivity, and mutagenesis studies. J Med Chem. 2008 Nov 13;51(21):6829-38. | |||||
REF 90 | Pharmacophore-guided drug discovery investigations leading to bioactive 5-aminotetrahydropyrazolopyridines. Implications for the binding mode of he... J Med Chem. 2005 Sep 8;48(18):5771-9. | |||||
REF 91 | Evaluation of cis- and trans-9- and 11-hydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridines as structurally rigid, selective D1 dopamine recepto... J Med Chem. 1995 Jan 20;38(2):318-27. | |||||
REF 92 | Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. | |||||
REF 93 | Modified ibogaine fragments: synthesis and preliminary pharmacological characterization of 3-ethyl-5-phenyl-1,2,3,4,5, 6-hexahydroazepino[4,5-b]ben... J Med Chem. 1998 Nov 5;41(23):4486-91. | |||||
REF 94 | Dopamine modulates effort-based decision making in rats. Behav Neurosci. 2009 Apr;123(2):242-51. | |||||
REF 95 | Synthesis and pharmacological characterization of 1-phenyl-, 4-phenyl-, and 1-benzyl-1,2,3,4-tetrahydroisoquinolines as dopamine receptor ligands. J Med Chem. 1988 Oct;31(10):1941-6. | |||||
REF 96 | trans-10,11-dihydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridine: a highly potent selective dopamine D1 full agonist. J Med Chem. 1990 Jun;33(6):1756-64. | |||||
REF 97 | Dopamine receptor agonists: selectivity and dopamine D1 receptor efficacy. Eur J Pharmacol. 1990 Jun 12;188(6):335-47. | |||||
REF 98 | Identification of G protein-biased agonists that fail to recruit beta-arrestin or promote internalization of the D1 dopamine receptor. ACS Chem Neurosci. 2015 Apr 15;6(4):681-92. | |||||
REF 99 | Dibenzazecine scaffold rebuilding--is the flexibility always essential for high dopamine receptor affinities Bioorg Med Chem. 2009 Oct 1;17(19):6898-907. | |||||
REF 100 | N-(Iodopropenyl)-octahydrobenzo[f]- and -[g]quinolines: synthesis and adrenergic and dopaminergic activity studies. J Med Chem. 1998 Oct 8;41(21):4165-70. | |||||
REF 101 | Molecular cloning and expression of the gene for a human D1 dopamine receptor. Nature. 1990 Sep 6;347(6288):72-6. | |||||
REF 102 | Ligand recognition and biased agonism of the D1 dopamine receptor. Nat Commun. 2022 Jun 8;13(1):3186. | |||||
REF 103 | Structural insights into the human D1 and D2 dopamine receptor signaling complexes. Cell. 2021 Feb 18;184(4):931-942.e18. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.