Target Regulator(s) Information (Transcription Factor)
Target General Information | Top | ||||
---|---|---|---|---|---|
Target ID | T60366 | Target Info | |||
Target Name | Ornithine decarboxylase (ODC1) | ||||
Synonyms | ODC | ||||
Target Type | Successful Target | ||||
Gene Name | ODC1 | ||||
Biochemical Class | Carbon-carbon lyase | ||||
UniProt ID |
The Transcription Factors (TFs) Regulating This Target | Top | ||||
---|---|---|---|---|---|
TF Name | c-Myc proto-oncogene (MYC) | ||||
Classification | Superclass | Basic Domains | |||
Class | Helix-loop-helix / leucine zipper factors (bHLH-ZIP) | ||||
Family | Cell-cycle controlling factors | ||||
Subfamily | Myc | ||||
Regulation Mechanism | C-Myc is a potent transactivator of ODC promoter-reporter gene constructs in fibroblasts that requires the CACGTG repeat. | [1] | |||
Evidence Score (E-score) | 2 | + | |||
UniProt ID | |||||
Sequence |
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL RKRREQLKHKLEQLRNSCA |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Eukaryotic initiation factors | [+] 1 Eukaryotic initiation factors Co-regulated By This TF | + | |||
G protein-coupled receptors | [+] 1 G protein-coupled receptors Co-regulated By This TF | + | |||
Kinases | [+] 2 Kinases Co-regulated By This TF | + | |||
Lyases | [+] 1 Lyases Co-regulated By This TF | + | |||
Transcription factors | [+] 1 Transcription factors Co-regulated By This TF | + | |||
TF Name | Myc-associated factor X (MAX) homodimer | ||||
Classification | Superclass | Basic Domains | |||
Class | Helix-loop-helix / leucine zipper factors (bHLH-ZIP) | ||||
Family | Cell-cycle controlling factors | ||||
Subfamily | Mad/Max | ||||
Regulation Mechanism | MAX is a potent transactivator of ODC promoter-reporter gene constructs in fibroblasts that requires the CACGTG repeat. | [1] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR
AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Lyases | [+] 1 Lyases Co-regulated By This TF | + |
References | Top | ||||
---|---|---|---|---|---|
REF 1 | The ornithine decarboxylase gene is a transcriptional target of c-Myc. Proc Natl Acad Sci U S A. 1993 Aug 15;90(16):7804-8. | ||||
REF 2 | Associations of a polymorphism in the ornithine decarboxylase gene with colorectal cancer survival. Clin Cancer Res. 2009 Oct 1;15(19):6208-16. | ||||
REF 3 | An essential E box in the promoter of the gene encoding the mRNA cap-binding protein (eukaryotic initiation factor 4E) is a target for activation by c-myc. Mol Cell Biol. 1996 Sep;16(9):4754-64. | ||||
REF 4 | USF/c-Myc enhances, while Yin-Yang 1 suppresses, the promoter activity of CXCR4, a coreceptor for HIV-1 entry. J Immunol. 1999 May 15;162(10):5986-92. | ||||
REF 5 | c-myc reverses neu-induced transformed morphology by transcriptional repression. Mol Cell Biol. 1991 Jan;11(1):354-62. | ||||
REF 6 | Sp1 cooperates with c-Myc to activate transcription of the human telomerase reverse transcriptase gene (hTERT). Nucleic Acids Res. 2000 Feb 1;28(3):669-77. | ||||
REF 7 | Identification of positively and negatively acting elements regulating expression of the E2F2 gene in response to cell growth signals. Mol Cell Biol. 1997 Sep;17(9):5227-35. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.