Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T01283
(Former ID: TTDI02200)
|
|||||
Target Name |
Tumor susceptibility gene protein 101 (TSG101)
|
|||||
Synonyms |
Tumor susceptibility gene 101 protein; ESCRT-I complex subunit TSG101
|
|||||
Gene Name |
TSG101
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Influenza [ICD-11: 1E30-1E32] | |||||
Function |
Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses. Required for the exosomal release of SDCBP, CD63 and syndecan. It may also play a role in the extracellular release of microvesicles that differ from the exosomes. Component of the ESCRT-I complex, a regulator of vesicular trafficking process.
Click to Show/Hide
|
|||||
BioChemical Class |
Ubiquitin-conjugating enzyme
|
|||||
UniProt ID | ||||||
Sequence |
MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIP
VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP QSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPP NPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRW RMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSS ALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFL KHVRLLSRKQFQLRALMQKARKTAGLSDLY Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | FGI-101-1A6 | Drug Info | Phase 1 | Influenza virus infection | [1] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-interacting Proteins |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
1 | Endocytosis | |||||
PID Pathway | [+] 2 PID Pathways | + | ||||
1 | Glucocorticoid receptor regulatory network | |||||
2 | Internalization of ErbB1 | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Budding and maturation of HIV virion | |||||
2 | Membrane binding and targetting of GAG proteins | |||||
WikiPathways | [+] 2 WikiPathways | + | ||||
1 | HIV Life Cycle | |||||
2 | Membrane Trafficking |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | ClinicalTrials.gov (NCT01299142) Safety and Pharmacokinetics Study of Human Monoclonal Antibody (FGI-101-1A6). U.S. National Institutes of Health. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.