Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T28692
(Former ID: TTDS00066)
|
|||||
Target Name |
Lipoprotein lipase (LPL)
|
|||||
Synonyms |
LIPD
|
|||||
Gene Name |
LPL
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Hyper-lipoproteinaemia [ICD-11: 5C80] | |||||
Function |
Catalyzes the hydrolysis of triglycerides from circulating chylomicrons and very low density lipoproteins (VLDL), and thereby plays an important role in lipid clearance from the blood stream, lipid utilization and storage. Mediates margination of triglyceride-rich lipoprotein particles in capillaries. Recruited to its site of action on the luminal surface of vascular endothelium by binding to GPIHBP1 and cell surface heparan sulfate proteoglycans. Key enzyme in triglyceride metabolism.
Click to Show/Hide
|
|||||
BioChemical Class |
Carboxylic ester hydrolase
|
|||||
UniProt ID | ||||||
EC Number |
EC 3.1.1.34
|
|||||
Sequence |
MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGV
AESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEH YPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRIT GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKG LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQ AFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
ADReCS ID | BADD_A01285 ; BADD_A02260 ; BADD_A02367 ; BADD_A03749 ; BADD_A04520 ; BADD_A05675 | |||||
HIT2.0 ID | T99EYH |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 2 Approved Drugs | + | ||||
1 | Clofibrate | Drug Info | Approved | Dysbetalipoproteinemia | [2], [3] | |
2 | Gemfibrozil | Drug Info | Approved | Hyperlipidaemia | [4], [5] | |
Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
1 | AMT-011 | Drug Info | Phase 3 | Blood forming organ disorder | [6] | |
2 | Ibrolipim | Drug Info | Phase 2 | Hyperlipidaemia | [7] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Activator | [+] 2 Activator drugs | + | ||||
1 | Clofibrate | Drug Info | [1] | |||
2 | Gemfibrozil | Drug Info | [8] | |||
Modulator | [+] 3 Modulator drugs | + | ||||
1 | AMT-011 | Drug Info | [6] | |||
2 | Ibrolipim | Drug Info | [6], [7] | |||
3 | WS-070117 | Drug Info | [6] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-regulating Transcription Factors |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Effects of clofibrate treatment in laying hens. Poult Sci. 2007 Jun;86(6):1187-95. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2667). | |||||
REF 3 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070531. | |||||
REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3439). | |||||
REF 5 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074256. | |||||
REF 6 | Alipogene tiparvovec for the treatment of lipoprotein lipase deficiency. Drugs Today (Barc). 2013 Mar;49(3):161-70. | |||||
REF 7 | NO-1886 (ibrolipim), a lipoprotein lipase activator, increases the expression of uncoupling protein 3 in skeletal muscle and suppresses fat accumulation in high-fat diet-induced obesity in rats. Metabolism. 2005 Dec;54(12):1587-92. | |||||
REF 8 | Mode of action of fibrates in the regulation of triglyceride and HDL-cholesterol metabolism. Drugs Today (Barc). 2006 Jan;42(1):39-64. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.