Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T29960
(Former ID: TTDR00688)
|
|||||
| Target Name |
Wilms tumor protein (WT1)
|
|||||
| Synonyms |
Wilms' tumour 1 protein; WT33; WT1 protein
|
|||||
| Gene Name |
WT1
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 4 Target-related Diseases | + | ||||
| 1 | Malignant haematopoietic neoplasm [ICD-11: 2B33] | |||||
| 2 | Leukaemia [ICD-11: 2A60-2B33] | |||||
| 3 | Acute myeloid leukaemia [ICD-11: 2A60] | |||||
| 4 | Lung cancer [ICD-11: 2C25] | |||||
| Function |
Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'. Regulates the expression of numerous target genes, including EPO. Plays an essential role for development of the urogenital system. It has a tumor suppressor as well as an oncogenic role in tumor formation. Function may be isoform-specific: isoforms lacking the KTS motif may act as transcription factors. Isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing. Isoform 1 has lower affinity for DNA, and can bind RNA. Transcription factor that plays an important role in cellular development and cell survival.
Click to Show/Hide
|
|||||
| BioChemical Class |
EGR C2H2-type zinc-finger
|
|||||
| UniProt ID | ||||||
| Sequence |
MGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLGGPAPPPAP
PPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQA SSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHED PMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQ MNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDV RRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDC ERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPS CQKKFARSDELVRHHNMHQRNMTKLQLAL Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| HIT2.0 ID | T28V82 | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 7 Clinical Trial Drugs | + | ||||
| 1 | Combined PR1/WT1 vaccine | Drug Info | Phase 2 | Myeloid leukaemia | [2] | |
| 2 | FPI-01 | Drug Info | Phase 2 | Acute myeloid leukaemia | [3] | |
| 3 | WT1 peptide vaccine | Drug Info | Phase 2 | leukaemia | [4] | |
| 4 | WT1-targeted autologous dendritic cell vaccine | Drug Info | Phase 2 | Acute myeloid leukaemia | [1] | |
| 5 | WT-4869 | Drug Info | Phase 1/2 | leukaemia | [5] | |
| 6 | GSK-2130579A | Drug Info | Phase 1 | Acute myeloid leukaemia | [6] | |
| 7 | INNO-305 | Drug Info | Phase 1 | Lung cancer | [7] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Modulator | [+] 2 Modulator drugs | + | ||||
| 1 | WT-4869 | Drug Info | [11] | |||
| 2 | INNO-305 | Drug Info | [13] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-regulating Transcription Factors | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
| 1 | Transcriptional misregulation in cancer | |||||
| NetPath Pathway | [+] 2 NetPath Pathways | + | ||||
| 1 | FSH Signaling Pathway | |||||
| 2 | IL5 Signaling Pathway | |||||
| PID Pathway | [+] 2 PID Pathways | + | ||||
| 1 | p73 transcription factor network | |||||
| 2 | Regulation of Telomerase | |||||
| WikiPathways | [+] 2 WikiPathways | + | ||||
| 1 | Primary Focal Segmental Glomerulosclerosis FSGS | |||||
| 2 | Integrated Pancreatic Cancer Pathway | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | ClinicalTrials.gov (NCT01686334) Efficacy Study of Dendritic Cell Vaccination in Patients With Acute Myeloid Leukemia in Remission. U.S. National Institutes of Health. | |||||
| REF 2 | Review of the Results of WT1 Peptide Vaccination Strategies for Myelodysplastic Syndromes and Acute Myeloid Leukemia from Nine Different Studies. Front Immunol. 2015 Feb 4;6:36. | |||||
| REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800040574) | |||||
| REF 4 | ClinicalTrials.gov (NCT01266083) Trial of a WT-1 Analog Peptide Vaccine in Patients With Acute Myeloid Leukemia (AML) or Acute Lymphoblastic Leukemia (ALL). U.S. National Institutes of Health. | |||||
| REF 5 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033385) | |||||
| REF 6 | ClinicalTrials.gov (NCT01051063) Evaluation of a New Anti-cancer Immunotherapy in Adult Acute Myeloid Leukemia Patients With a Suboptimal Clinical Response to Induction Chemotherapy. U.S. National Institutes of Health. | |||||
| REF 7 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023753) | |||||
| REF 8 | Leukemia-associated antigen-specific T-cell responses following combined PR1 and WT1 peptide vaccination in patients with myeloid malignancies. Blood. 2008 Jan 1;111(1):236-42. | |||||
| REF 9 | Clinical pipeline report, company report or official report of Formula Pharmaceuticals. | |||||
| REF 10 | Wilms' tumor protein 1 (WT1) peptide vaccination in AML patients: predominant TCR CDR3beta sequence associated with remission in one patient is detectable in other vaccinated patients. Cancer ImmunolImmunother. 2012 Mar;61(3):313-22. | |||||
| REF 11 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033385) | |||||
| REF 12 | Spoilight on personalized medicine. A pharma matters report, Thomson Reuters, 2012. | |||||
| REF 13 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023753) | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.