Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T44919
|
|||||
| Target Name |
Glucagon (GCG)
|
|||||
| Synonyms |
GRPP; GLP2; GLP1; GLP-1
|
|||||
| Gene Name |
GCG
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 4 Target-related Diseases | + | ||||
| 1 | Obesity [ICD-11: 5B80-5B81] | |||||
| 2 | Type 2 diabetes mellitus [ICD-11: 5A11] | |||||
| 3 | Acute diabete complication [ICD-11: 5A2Y] | |||||
| 4 | Diabetes mellitus [ICD-11: 5A10] | |||||
| Function |
Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.
Click to Show/Hide
|
|||||
| BioChemical Class |
Glucagon
|
|||||
| UniProt ID | ||||||
| Sequence |
MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTS
DYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI AWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| HIT2.0 ID | T02DEN | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 6 Clinical Trial Drugs | + | ||||
| 1 | JNJ-64565111 | Drug Info | Phase 2 | Obesity | [2] | |
| 2 | MEDI0382 | Drug Info | Phase 2 | Type-2 diabetes | [3] | |
| 3 | MK-8521 | Drug Info | Phase 2 | Type-2 diabetes | [1], [4] | |
| 4 | PB-1023 | Drug Info | Phase 2 | Type-2 diabetes | [1], [5] | |
| 5 | SAR425899 | Drug Info | Phase 1 | Diabetic complication | [6] | |
| 6 | ZP2929 | Drug Info | Phase 1 | Type-1 diabetes | [1] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Agonist | [+] 5 Agonist drugs | + | ||||
| 1 | JNJ-64565111 | Drug Info | [1] | |||
| 2 | MEDI0382 | Drug Info | [1] | |||
| 3 | PB-1023 | Drug Info | [1] | |||
| 4 | SAR425899 | Drug Info | [1] | |||
| 5 | ZP2929 | Drug Info | [1] | |||
| Co-agonist | [+] 1 Co-agonist drugs | + | ||||
| 1 | MK-8521 | Drug Info | [1] | |||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-interacting Proteins | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 5 KEGG Pathways | + | ||||
| 1 | cAMP signaling pathway | |||||
| 2 | Neuroactive ligand-receptor interaction | |||||
| 3 | Thermogenesis | |||||
| 4 | Insulin secretion | |||||
| 5 | Glucagon signaling pathway | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 2 | ClinicalTrials.gov (NCT03486392) A Study to Evaluate the Safety and Efficacy of JNJ-64565111 in Non-diabetic Severely Obese Participants. U.S. National Institutes of Health. | |||||
| REF 3 | ClinicalTrials.gov (NCT03596177) A Study to Evaluate the Effect of MEDI0382 on Energy Balance in Overweight and Obese Participants With Type 2 Diabetes Mellitus. U.S. National Institutes of Health. | |||||
| REF 4 | ClinicalTrials.gov (NCT02492763) A Preliminary Study of the Efficacy and Safety of MK-8521 for Type 2 Diabetes (MK-8521-004). | |||||
| REF 5 | Clinical pipeline report, company report or official report of PhaseBio Pharmaceuticals. | |||||
| REF 6 | ClinicalTrials.gov (NCT02411825) Multiple Ascending Dose Study in Healthy Male Subjects. U.S. National Institutes of Health. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.