Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T01110
(Former ID: TTDNC00521)
|
|||||
| Target Name |
Colony stimulating factor-1 receptor (CSF-1R)
|
|||||
| Synonyms |
Macrophage colony-stimulating factor 1 receptor
Click to Show/Hide
|
|||||
| Gene Name |
CSF1R
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 8 Target-related Diseases | + | ||||
| 1 | Hodgkin lymphoma [ICD-11: 2B30] | |||||
| 2 | Metastatic tumour [ICD-11: 2D50-2E2Z] | |||||
| 3 | Rheumatoid arthritis [ICD-11: FA20] | |||||
| 4 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| 5 | Diabetes mellitus [ICD-11: 5A10] | |||||
| 6 | Bone/articular cartilage neoplasm [ICD-11: 2F7B] | |||||
| 7 | Breast cancer [ICD-11: 2C60-2C6Y] | |||||
| 8 | Inflammatory arthropathy [ICD-11: FA2Z] | |||||
| Function |
A cytokine which controls the production, differentiation, and function of macrophages.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTL
YSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED QDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSAL MGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHN NTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHN QTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKY KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGTVA SPARVWTPMWR Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 8 Clinical Trial Drugs | + | ||||
| 1 | ARRY-382 | Drug Info | Phase 2 | Solid tumour/cancer | [2] | |
| 2 | JNJ-40346527 | Drug Info | Phase 2 | Hodgkin lymphoma | [3] | |
| 3 | MCS-110 | Drug Info | Phase 2 | Bone metastases | [4] | |
| 4 | PD-360324 | Drug Info | Phase 2 | Rheumatoid arthritis | [5] | |
| 5 | RG7155 | Drug Info | Phase 2 | Solid tumour/cancer | [6] | |
| 6 | FPA-008 | Drug Info | Phase 1/2 | Autoimmune diabetes | [7] | |
| 7 | AMG 820 | Drug Info | Phase 1 | Solid tumour/cancer | [8] | |
| 8 | IMC-CS4 | Drug Info | Phase 1 | Solid tumour/cancer | [9] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Modulator | [+] 8 Modulator drugs | + | ||||
| 1 | ARRY-382 | Drug Info | [10] | |||
| 2 | JNJ-40346527 | Drug Info | [11] | |||
| 3 | MCS-110 | Drug Info | [1] | |||
| 4 | PD-360324 | Drug Info | [12] | |||
| 5 | RG7155 | Drug Info | [13] | |||
| 6 | FPA-008 | Drug Info | [14] | |||
| 7 | AMG 820 | Drug Info | [1] | |||
| 8 | IMC-CS4 | Drug Info | [1] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | |||||
| REF 2 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 3 | ClinicalTrials.gov (NCT01597739) A Study of JNJ-40346527 in Patients With Active Rheumatoid Arthritis Despite Disease-modifying Antirheumatic Drug Therapy. U.S. National Institutes of Health. | |||||
| REF 4 | ClinicalTrials.gov (NCT01643850) MCS110 in Patients With Pigmented Villonodular Synovitis (PVNS) or Giant Cell Tumor of the Tendon Sheath (GCTTS). U.S. National Institutes of Health. | |||||
| REF 5 | ClinicalTrials.gov (NCT01732211) A Phase 2, Safety, Tolerability, and Efficacy Study of PD 0360324 in Chronic Pulmonary Sarcoidosis. U.S. National Institutes of Health. | |||||
| REF 6 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035593) | |||||
| REF 7 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800039179) | |||||
| REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031593) | |||||
| REF 9 | ClinicalTrials.gov (NCT01346358) A Study of IMC-CS4 in Subjects With Advanced Solid Tumors. U.S. National Institutes of Health. | |||||
| REF 10 | Company report (Array) | |||||
| REF 11 | An Open-Label, Multicenter, Phase I/II Study of JNJ-40346527, a CSF-1R Inhibitor, in Patients with Relapsed or Refractory Hodgkin Lymphoma. Clin Cancer Res. 2015 Apr 15;21(8):1843-50. | |||||
| REF 12 | Monoclonal antibody against macrophage colony-stimulating factor suppresses circulating monocytes and tissue macrophage function but does not alter cell infiltration/activation in cutaneous lesions or clinical outcomes in patients with cutaneous lupus erythematosus.Clin Exp Immunol.2016 Feb;183(2):258-70. | |||||
| REF 13 | Targeting tumor-associated macrophages with anti-CSF-1R antibody reveals a strategy for cancer therapy. Cancer Cell. 2014 Jun 16;25(6):846-59. | |||||
| REF 14 | Company report (Five Prime Therapeutics) | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.