Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T02617
(Former ID: TTDI02373)
|
|||||
Target Name |
Transferrin (TF)
|
|||||
Synonyms |
Siderophilin; Serotransferrin; PRO1400; Beta-1 metal-binding globulin
|
|||||
Gene Name |
TF
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
Function |
It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Serum transferrin may also have a further role in stimulating cell proliferation. Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate.
Click to Show/Hide
|
|||||
BioChemical Class |
Transferrin
|
|||||
UniProt ID | ||||||
Sequence |
MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVK
KASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVV KKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPC ADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRD QYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKE FQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPTDECKP VKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGK CGLVPVLAENYNKSDNCEDTPEAGYFAIAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWN IPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAF RCLVEKGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLAR APNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKL HDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
ADReCS ID | BADD_A00140 ; BADD_A02651 ; BADD_A05231 | |||||
HIT2.0 ID | T20MBF |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | CALAA-01 | Drug Info | Phase 1 | Solid tumour/cancer | [2] | |
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | EP-2167 | Drug Info | Preclinical | Solid tumour/cancer | [3] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | CALAA-01 | Drug Info | [1] | |||
Inducer | [+] 1 Inducer drugs | + | ||||
1 | EP-2167 | Drug Info | [4] |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-regulating Transcription Factors |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
1 | HIF-1 signaling pathway | |||||
2 | Mineral absorption | |||||
NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
1 | TGF_beta_Receptor Signaling Pathway | |||||
PID Pathway | [+] 2 PID Pathways | + | ||||
1 | EPHB forward signaling | |||||
2 | HIF-1-alpha transcription factor network | |||||
Reactome | [+] 3 Reactome Pathways | + | ||||
1 | Platelet degranulation | |||||
2 | Iron uptake and transport | |||||
3 | Transferrin endocytosis and recycling | |||||
WikiPathways | [+] 4 WikiPathways | + | ||||
1 | SIDS Susceptibility Pathways | |||||
2 | Differentiation Pathway | |||||
3 | Iron uptake and transport | |||||
4 | Iron metabolism in placenta |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | |||||
REF 2 | ClinicalTrials.gov (NCT00689065) Safety Study of CALAA-01 to Treat Solid Tumor Cancers. U.S. National Institutes of Health. | |||||
REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017941) | |||||
REF 4 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017941) |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.