Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T06800
(Former ID: TTDR00493)
|
|||||
Target Name |
Suppressor of cytokine signaling 1 (SOCS1)
|
|||||
Synonyms |
Tec-interacting protein 3; TIP3; TIP-3; STAT-induced STAT inhibitor 1; STAT induced STAT inhibitor 1; SSI1; SSI-1; SOCS-1; JAK-binding protein; JAB
|
|||||
Gene Name |
SOCS1
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
SOCS1 is involved in negative regulation of cytokines that signal through the JAK/STAT3 pathway. Through binding to JAKs, inhibits their kinase activity. In vitro, also suppresses Tec protein-tyrosine activity. Appears to be a major regulator of signaling by interleukin 6 (IL6) and leukemia inhibitory factor (LIF). Regulates interferon-gamma mediated sensory neuron survival. Probable substrate recognition component of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize JAK2. SOCS1 appears to be a negative regulator in IGF1R signaling pathway. SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRS
HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ RIVATVGRENLARIPLNPVLRDYLSSFPFQI Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T15UBS |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-interacting Proteins |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | The suppressor of cytokine signaling-1 (SOCS1) is a novel therapeutic target for enterovirus-induced cardiac injury. J Clin Invest. 2003 Feb;111(4):469-78. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.