Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T15344
(Former ID: TTDI02197)
|
|||||
| Target Name |
Activation-inducible TNFR family receptor (TNFRSF18)
|
|||||
| Synonyms |
UNQ319/PRO364; Tumor necrosis factor receptor superfamily member 18; Glucocorticoid-induced TNFR-related protein; GITR; CD357; AITR
|
|||||
| Gene Name |
TNFRSF18
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 3 Target-related Diseases | + | ||||
| 1 | Melanoma [ICD-11: 2C30] | |||||
| 2 | Metastatic lymph node neoplasm [ICD-11: 2D60] | |||||
| 3 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| Function |
Seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. Mediated NF-kappa-B activation via the TRAF2/NIK pathway. Receptor for TNFSF18.
Click to Show/Hide
|
|||||
| BioChemical Class |
Cytokine receptor
|
|||||
| UniProt ID | ||||||
| Sequence |
MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRD
YPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTF SGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEPLGWLTVVLLAVAACVLLL TSAQLGLHIWQLRSQCMWPRETQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLW V Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 8 Clinical Trial Drugs | + | ||||
| 1 | INCAGN01876 | Drug Info | Phase 2 | Solid tumour/cancer | [2] | |
| 2 | INCAGN1876 | Drug Info | Phase 1/2 | Solid tumour/cancer | [3], [4] | |
| 3 | TRX-518 | Drug Info | Phase 1/2 | Solid tumour/cancer | [3], [4] | |
| 4 | AMG 228 | Drug Info | Phase 1 | Solid tumour/cancer | [5] | |
| 5 | ASP1951 | Drug Info | Phase 1 | Solid tumour/cancer | [6] | |
| 6 | MK-4166 | Drug Info | Phase 1 | Solid tumour/cancer | [7] | |
| 7 | REGN6569 | Drug Info | Phase 1 | Squamous head and neck cell carcinom | [8] | |
| 8 | TRX518 | Drug Info | Phase 1 | Solid tumour/cancer | [9] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Agonist | [+] 4 Agonist drugs | + | ||||
| 1 | INCAGN01876 | Drug Info | [10] | |||
| 2 | INCAGN1876 | Drug Info | [3] | |||
| 3 | AMG 228 | Drug Info | [11] | |||
| 4 | ASP1951 | Drug Info | [6] | |||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | REGN6569 | Drug Info | [13] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-interacting Proteins | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
| 1 | Cytokine-cytokine receptor interaction | |||||
| NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
| 1 | TCR Signaling Pathway | |||||
| PID Pathway | [+] 2 PID Pathways | + | ||||
| 1 | Downstream signaling in naï | |||||
| 2 | ||||||
| Reactome | [+] 1 Reactome Pathways | + | ||||
| 1 | TNFs bind their physiological receptors | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Immuno-oncology moves beyond PD-1. Nat Biotechnol. 2015 Jul;33(7):673-5. | |||||
| REF 2 | ClinicalTrials.gov (NCT03277352) INCAGN01876 in Combination With Immune Therapies in Subjects With Advanced or Metastatic Malignancies. U.S. National Institutes of Health. | |||||
| REF 3 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 4 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 5 | ClinicalTrials.gov (NCT02437916) Safety Study of AMG 228 to Treat Solid Tumors. U.S. National Institutes of Health. | |||||
| REF 6 | ClinicalTrials.gov (NCT03799003) A Study of ASP1951 in Subjects With Advanced Solid Tumors. U.S. National Institutes of Health. | |||||
| REF 7 | ClinicalTrials.gov (NCT02132754) Study of MK-4166 in Participants With Advanced Solid Tumors (MK-4166-001). U.S. National Institutes of Health. | |||||
| REF 8 | ClinicalTrials.gov (NCT04465487) Study of REGN6569 and Cemiplimab in Adult Patients With Advanced Solid Tumor Malignancies. U.S. National Institutes of Health. | |||||
| REF 9 | ClinicalTrials.gov (NCT02628574) Phase 1 Open-label Study of TRX518 Monotherapy and TRX518 in Combination With Gemcitabine, Pembrolizumab, or Nivolumab. U.S. National Institutes of Health. | |||||
| REF 10 | Clinical pipeline report, company report or official report of Agenus. | |||||
| REF 11 | Dose escalation results from a first-in-human, phase 1 study of glucocorticoid-induced TNF receptor-related protein agonist AMG 228 in patients with advanced solid tumors. J Immunother Cancer. 2018 Sep 25;6(1):93. | |||||
| REF 12 | Immuno-oncology moves beyond PD-1. Nat Biotechnol. 2015 Jul;33(7):673-5. | |||||
| REF 13 | Clinical pipeline report, company report or official report of Regeneron Pharmaceuticals. | |||||
| REF 14 | Clinical pipeline report, company report or official report of Leap Therapeutics. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.