Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T19784
(Former ID: TTDR01048)
|
|||||
| Target Name |
Somatotropin (GH1)
|
|||||
| Synonyms |
Pituitary growth hormone; Growth hormone 1; Growth hormone; GH-N; GH
|
|||||
| Gene Name |
GH1
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Multiple structural anomalies syndrome [ICD-11: LD2F] | |||||
| 2 | Pituitary gland disorder [ICD-11: 5A60-5A61] | |||||
| Function |
Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
Click to Show/Hide
|
|||||
| BioChemical Class |
Somatotropin/prolactin
|
|||||
| UniProt ID | ||||||
| Sequence |
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
| HIT2.0 ID | T24VFB | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 6 Clinical Trial Drugs | + | ||||
| 1 | Albutropin | Drug Info | Phase 3 | Growth failure | [2] | |
| 2 | HGH-CTP | Drug Info | Phase 3 | Growth hormone deficiency | [3] | |
| 3 | VRS-317 | Drug Info | Phase 3 | Growth hormone deficiency | [4] | |
| 4 | ACP-001 | Drug Info | Phase 2 | Growth hormone deficiency | [5] | |
| 5 | Somatropin intranasal rhGH | Drug Info | Phase 2 | Growth hormone deficiency | [6] | |
| 6 | YPEG-Somatropin | Drug Info | Phase 1 | Growth hormone deficiency | [7] | |
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | ARX-201 | Drug Info | Discontinued in Phase 2 | Growth failure | [8] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Modulator | [+] 6 Modulator drugs | + | ||||
| 1 | Albutropin | Drug Info | [9] | |||
| 2 | VRS-317 | Drug Info | [10] | |||
| 3 | ACP-001 | Drug Info | [5] | |||
| 4 | Somatropin intranasal rhGH | Drug Info | [11] | |||
| 5 | YPEG-Somatropin | Drug Info | [12] | |||
| 6 | ARX-201 | Drug Info | [13] | |||
| Agonist | [+] 1 Agonist drugs | + | ||||
| 1 | HGH-CTP | Drug Info | [1] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating Transcription Factors | ||||||
| Target-interacting Proteins | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 4 KEGG Pathways | + | ||||
| 1 | Cytokine-cytokine receptor interaction | |||||
| 2 | Neuroactive ligand-receptor interaction | |||||
| 3 | PI3K-Akt signaling pathway | |||||
| 4 | Jak-STAT signaling pathway | |||||
| Reactome | [+] 2 Reactome Pathways | + | ||||
| 1 | Prolactin receptor signaling | |||||
| 2 | Growth hormone receptor signaling | |||||
| WikiPathways | [+] 5 WikiPathways | + | ||||
| 1 | Endochondral Ossification | |||||
| 2 | Prolactin receptor signaling | |||||
| 3 | Growth hormone receptor signaling | |||||
| 4 | Adipogenesis | |||||
| 5 | Synthesis, Secretion, and Deacylation of Ghrelin | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Developments in human growth hormone preparations: sustained-release, prolonged half-life, novel injection devices, and alternative delivery routes. Int J Nanomedicine. 2014; 9: 3527-3538. | |||||
| REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016005) | |||||
| REF 3 | ClinicalTrials.gov (NCT01909479) A Phase 3, Multicenter Study Designed To Evaluate The Efficacy And Safety Of A Long Acting Hgh Product (Mod-4023) In Adult Subjects With Growth Hormone Deficiency. U.S. National Institutes of Health. | |||||
| REF 4 | ClinicalTrials.gov (NCT02339090) Comparison of Long-acting Growth Hormone VRS-317 to Daily Growth Hormone in Pediatric GHD Patients. U.S. National Institutes of Health. | |||||
| REF 5 | ClinicalTrials.gov (NCT01947907) Safety, PK/PD and Efficacy of ACP-001 Weekly Versus Daily hGH in Children With Growth Hormone Deficiency (GHD). U.S. National Institutes of Health. | |||||
| REF 6 | ClinicalTrials.gov (NCT00837863) Study of Weekly ALTU-238 Compared With Daily Nutropin AQ in Prepubertal Children With Growth Hormone Deficiency. U.S. National Institutes of Health. | |||||
| REF 7 | ClinicalTrials.gov (NCT01339182) Safety, Tolerability, Pharmacokinetics and Pharmacodynamics Study of Pegylated-Somatropin in Healthy Volunteers. U.S. National Institutes of Health. | |||||
| REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800022324) | |||||
| REF 9 | Albutropin: a growth hormone-albumin fusion with improved pharmacokinetics and pharmacodynamics in rats and monkeys. Eur J Pharmacol. 2002 Dec 5;456(1-3):149-58. | |||||
| REF 10 | Company report (Versartis) | |||||
| REF 11 | Long-term efficacy and safety of somatropin for adult growth hormone deficiency.Treat Endocrinol.2003;2(2):109-20. | |||||
| REF 12 | Somatropin therapy in adults with Prader-Willi syndrome. Treat Endocrinol. 2004;3(3):153-60. | |||||
| REF 13 | Company report (Avarx) | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.