Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T20578
(Former ID: TTDI01952)
|
|||||
Target Name |
Phosphodiesterase 7B (PDE7B)
|
|||||
Synonyms |
cAMPspecific 3',5'cyclic phosphodiesterase 7B; cAMP-specific 3',5'-cyclic phosphodiesterase 7B
Click to Show/Hide
|
|||||
Gene Name |
PDE7B
|
|||||
Target Type |
Discontinued target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Pain [ICD-11: MG30-MG3Z] | |||||
Function |
May be involved in the control of cAMP-mediated neural activity and cAMP metabolism in the brain. Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.
Click to Show/Hide
|
|||||
BioChemical Class |
Phosphoric diester hydrolase
|
|||||
UniProt ID | ||||||
EC Number |
EC 3.1.4.53
|
|||||
Sequence |
MSCLMVERCGEILFENPDQNAKCVCMLGDIRLRGQTGVRAERRGSYPFIDFRLLNSTTYS
GEIGTKKKVKRLLSFQRYFHASRLLRGIIPQAPLHLLDEDYLGQARHMLSKVGMWDFDIF LFDRLTNGNSLVTLLCHLFNTHGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAAD VTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMS VLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN KDLRLEDAQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGELEQKFELEIS PLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSLLPRQ HRSRGSSGSGPDHDHAGQGTESEEQEGDSP Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
1 | PF-3557156 | Drug Info | Discontinued in Phase 1 | Pain | [2] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | PF-3557156 | Drug Info | [1] | |||
Inhibitor | [+] 2 Inhibitor drugs | + | ||||
1 | BRL50481 | Drug Info | [3] | |||
2 | SCH51866 | Drug Info | [4] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Human Similarity Proteins
Human Pathway Affiliation
|
There is no similarity protein (E value < 0.005) for this target
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
Purine metabolism | hsa00230 | Affiliated Target |
|
Class: Metabolism => Nucleotide metabolism | Pathway Hierarchy |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
1 | Purine metabolism | |||||
2 | Morphine addiction | |||||
Reactome | [+] 1 Reactome Pathways | + | ||||
1 | G alpha (s) signalling events | |||||
WikiPathways | [+] 1 WikiPathways | + | ||||
1 | G Protein Signaling Pathways |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Company report (Pfizer pipeline: October 28, 2008) | |||||
REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026842) | |||||
REF 3 | New classes of PDE7 inhibitors identified by a fission yeast-based HTS. J Biomol Screen. 2010 Apr;15(4):359-67. | |||||
REF 4 | Identification of human PDE7B, a cAMP-specific phosphodiesterase. Biochem Biophys Res Commun. 2000 May 19;271(3):575-83. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.