Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T21669
(Former ID: TTDI02088)
|
|||||
Target Name |
Glutathione S-transferase P (GSTP1)
|
|||||
Synonyms |
GSTP11; GSTP1-1; GST3; GST classpi; GST class-pi; FAEES3
|
|||||
Gene Name |
GSTP1
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
Function |
Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration. Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Click to Show/Hide
|
|||||
BioChemical Class |
Alkyl aryl transferase
|
|||||
UniProt ID | ||||||
EC Number |
EC 2.5.1.18
|
|||||
Sequence |
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY VGRLSARPKLKAFLASPEYVNLPINGNGKQ Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
HIT2.0 ID | T46AQJ |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
1 | Canfosfamide | Drug Info | Phase 3 | Solid tumour/cancer | [1] | |
2 | Ezatiostat | Drug Info | Phase 2 | Myelodysplastic syndrome | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Modulator | [+] 2 Modulator drugs | + | ||||
1 | Canfosfamide | Drug Info | [1], [3] | |||
2 | Ezatiostat | Drug Info | [4] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-regulating Transcription Factors | ||||||
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
BioCyc | [+] 2 BioCyc Pathways | + | ||||
1 | Glutathione-mediated detoxification | |||||
2 | 4-hydroxy-2-nonenal detoxification | |||||
KEGG Pathway | [+] 6 KEGG Pathways | + | ||||
1 | Glutathione metabolism | |||||
2 | Metabolism of xenobiotics by cytochrome P450 | |||||
3 | Drug metabolism - cytochrome P450 | |||||
4 | Pathways in cancer | |||||
5 | Chemical carcinogenesis | |||||
6 | Prostate cancer | |||||
NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
1 | TCR Signaling Pathway |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Mechanism of glutathione transferase P1-1-catalyzed activation of the prodrug canfosfamide (TLK286, TELCYTA). Biochemistry. 2013 Nov 12;52(45):8069-78. | |||||
REF 2 | ClinicalTrials.gov (NCT01422486) Phase 2 Study of Telintra in Deletion 5q Myelodysplastic Syndrome. U.S. National Institutes of Health. | |||||
REF 3 | Phase 1 study of TLK286 (Telcyta) administered weekly in advanced malignancies. Clin Cancer Res. 2004 Jun 1;10(11):3689-98. | |||||
REF 4 | National Cancer Institute Drug Dictionary (drug id 485244). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.