Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T32282
(Former ID: TTDR00418)
|
|||||
Target Name |
Prolactin (PRL)
|
|||||
Synonyms |
GHA1
|
|||||
Gene Name |
PRL
|
|||||
Target Type |
Discontinued target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Multiple sclerosis [ICD-11: 8A40] | |||||
Function |
Prolactin acts primarily on the mammary gland by promoting lactation.
Click to Show/Hide
|
|||||
BioChemical Class |
Somatotropin/prolactin
|
|||||
UniProt ID | ||||||
Sequence |
MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNL
SSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWN EPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSG LPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
HIT2.0 ID | T86YQL |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
1 | NTx-488 | Drug Info | Discontinued in Phase 2 | Multiple sclerosis | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | NTx-488 | Drug Info | [1] |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating Transcription Factors |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 5 KEGG Pathways | + | ||||
1 | Cytokine-cytokine receptor interaction | |||||
2 | Neuroactive ligand-receptor interaction | |||||
3 | PI3K-Akt signaling pathway | |||||
4 | Jak-STAT signaling pathway | |||||
5 | Prolactin signaling pathway | |||||
NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
1 | IL2 Signaling Pathway | |||||
PID Pathway | [+] 4 PID Pathways | + | ||||
1 | ErbB4 signaling events | |||||
2 | Signaling events mediated by PTP1B | |||||
3 | Glucocorticoid receptor regulatory network | |||||
4 | Validated nuclear estrogen receptor alpha network | |||||
Reactome | [+] 3 Reactome Pathways | + | ||||
1 | Prolactin receptor signaling | |||||
2 | Amyloid formation | |||||
3 | Growth hormone receptor signaling | |||||
WikiPathways | [+] 5 WikiPathways | + | ||||
1 | Prostaglandin Synthesis and Regulation | |||||
2 | EV release from cardiac cells and their functional effects | |||||
3 | Prolactin receptor signaling | |||||
4 | Growth hormone receptor signaling | |||||
5 | JAK/STAT |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028330) | |||||
REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028330) |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.