Target Information

Target General Information

Top

Target ID

T47657 (Former ID: TTDI03349)

Target Name

Leukocyte receptor tyrosine kinase (LTK)

Synonyms

TYK1; Protein tyrosine kinase 1; Leukocyte tyrosine kinase receptor

Click to Show/Hide

Gene Name

LTK

Target Type

Literature-reported target

[1]

Function

The exact function of this protein is not known. Studies with chimeric proteins (replacing its extracellular region with that of several known growth factor receptors, such as EGFR and CSFIR) demonstrate its ability to promote growth and specifically neurite outgrowth, and cell survival. Signaling appears to involve the PI3 kinase pathway. Involved in regulation of the secretory pathway involving endoplasmic reticulum (ER) export sites (ERESs) and ER to Golgi transport. Receptor with a tyrosine-protein kinase activity.

Click to Show/Hide

BioChemical Class

Kinase

UniProt ID

LTK_HUMAN

EC Number

EC 2.7.10.1

Sequence

MGCWGQLLVWFGAAGAILCSSPGSQETFLRSSPLPLASPSPRDPKVSAPPSILEPASPLN
SPGTEGSWLFSTCGASGRHGPTQTQCDGAYAGTSVVVTVGAAGQLRGVQLWRVPGPGQYL
ISAYGAAGGKGAKNHLSRAHGVFVSAIFSLGLGESLYILVGQQGEDACPGGSPESQLVCL
GESRAVEEHAAMDGSEGVPGSRRWAGGGGGGGGATYVFRVRAGELEPLLVAAGGGGRAYL
RPRDRGRTQASPEKLENRSEAPGSGGRGGAAGGGGGWTSRAPSPQAGRSLQEGAEGGQGC
SEAWATLGWAAAGGFGGGGGACTAGGGGGGYRGGDASETDNLWADGEDGVSFIHPSSELF
LQPLAVTENHGEVEIRRHLNCSHCPLRDCQWQAELQLAECLCPEGMELAVDNVTCMDLHK
PPGPLVLMVAVVATSTLSLLMVCGVLILVKQKKWQGLQEMRLPSPELELSKLRTSAIRTA
PNPYYCQVGLGPAQSWPLPPGVTEVSPANVTLLRALGHGAFGEVYEGLVIGLPGDSSPLQ
VAIKTLPELCSPQDELDFLMEALIISKFRHQNIVRCVGLSLRATPRLILLELMSGGDMKS
FLRHSRPHLGQPSPLVMRDLLQLAQDIAQGCHYLEENHFIHRDIAARNCLLSCAGPSRVA
KIGDFGMARDIYRASYYRRGDRALLPVKWMPPEAFLEGIFTSKTDSWSFGVLLWEIFSLG
YMPYPGRTNQEVLDFVVGGGRMDPPRGCPGPVYRIMTQCWQHEPELRPSFASILERLQYC
TQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWL
SSGLKPLKSRGLQPQNLWNPTYRS

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Similarity Proteins

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Similarity Proteins

Protein Name	Pfam ID	Percentage of Identity (%)	E value
Mixed lineage kinase 1 (MAP3K9)	PF00069 ; PF14604	30.065 (92/306)	1.84E-27
Serine/threonine-protein kinase Nek5 (NEK5)	PF00069	27.852 (83/298)	1.48E-19
Serine/threonine-protein kinase 24 (STK24)	PF00069	27.612 (74/268)	6.04E-18
Inhibitor of nuclear factor kappa-B kinase alpha (IKKA)	PF18397 ; PF12179 ; PF00069 More >>	29.954 (65/217)	1.58E-16
Serine/threonine-protein kinase 25 (STK25)	PF00069	26.667 (80/300)	1.87E-16
NUAK family SNF1-like kinase 2 (NUAK2)	PF00069	26.050 (62/238)	3.34E-16
Serine/threonine-protein kinase ULK1 (ULK1)	PF12063 ; PF00069	26.939 (66/245)	2.66E-15
NIMA-related kinase 7 (NEK7)	PF00069	24.832 (74/298)	2.78E-15
Myosin light chain kinase 3 (MYLK3)	PF00069	26.201 (60/229)	5.45E-15
Serine/threonine-protein kinase Nek3 (NEK3)	PF00069	25.000 (68/272)	1.31E-14
SPS1/STE20-related protein kinase YSK4 (YSK4)	PF00069	29.048 (61/210)	1.53E-14
Inhibitor of nuclear factor kappa-B kinase beta (IKKB)	PF18397 ; PF12179 ; PF00069 More >>	27.477 (61/222)	2.75E-14
Ribosomal protein S6 kinase alpha-2 (RSK2)	PF00069 ; PF00433	24.265 (66/272)	2.88E-14
Serine/threonine-protein kinase TAO2 (TAOK2)	PF00069	26.644 (77/289)	3.06E-14
Ribosomal protein S6 kinase alpha-3 (RSK3)	PF00069 ; PF00433	25.287 (66/261)	3.35E-14
Serine/threonine-protein kinase 26 (STK26)	PF00069	26.022 (70/269)	3.40E-14
PAK-1 protein kinase (PAK1)	PF00786 ; PF00069	24.561 (70/285)	8.04E-14
Serine/threonine-protein kinase ULK2 (ULK2)	PF12063 ; PF00069	26.549 (60/226)	9.44E-14
Aurora kinase A (AURKA)	PF00069	28.727 (79/275)	1.16E-13
PAK-2 protein kinase (PAK2)	PF00786 ; PF00069	24.825 (71/286)	1.61E-13
Serine/threonine-protein kinase Nek9 (NEK9)	PF00069 ; PF00415	23.466 (65/277)	2.54E-13
Serine/threonine-protein kinase PAK 3 (PAK3)	PF00786 ; PF00069	24.719 (66/267)	3.10E-13
Leucine-rich repeat kinase 2 (LRRK2)	PF16095 ; PF12799 ; PF13855 ; PF00069 ; PF08477 More >>	27.437 (76/277)	4.58E-13
Serine/threonine-protein kinase Nek4 (NEK4)	PF00069	26.568 (72/271)	4.92E-13
Ribosomal protein S6 kinase alpha-1 (RSK1)	PF00069 ; PF00433	25.523 (61/239)	6.55E-13
Ribosomal protein S6 kinase alpha-6 (RSK6)	PF00069 ; PF00433	24.364 (67/275)	7.45E-13
Unc-51 like kinase 3 (ULK3)	PF04212 ; PF00069	24.542 (67/273)	7.45E-13
NIMA-related kinase 6 (NEK6)	PF00069	22.768 (51/224)	8.76E-13
Serine/threonine-protein kinase Nek11 (NEK11)	PF00069	25.455 (70/275)	9.86E-13
Serine/threonine-protein kinase MAK (MAK)	PF00069	28.436 (60/211)	1.04E-12
Apoptosis signal-regulating kinase 2 (MAP3K6)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	26.493 (71/268)	1.07E-12
PKC-delta-interacting protein kinase (RIPK4)	PF12796 ; PF00069	26.199 (71/271)	2.30E-12
Myosin light chain kinase 2 (MYLK2)	PF00069	23.789 (54/227)	2.70E-12
MAP/microtubule affinity-regulating kinase 4 (MARK4)	PF02149 ; PF00069 ; PF00627 More >>	25.322 (59/233)	3.30E-12
Oxidative stress responsive 1 (OXSR1)	PF12202 ; PF00069	28.571 (74/259)	6.18E-12
Mitogen-activated protein kinase kinase kinase 15 (MAP3K15)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	26.038 (69/265)	7.67E-12
Serine/threonine-protein kinase 17B (STK17B)	PF00069	27.273 (51/187)	7.83E-12
Aurora kinase C (AURKC)	PF00069	24.555 (69/281)	8.95E-12
Serine/threonine-protein kinase PAK 6 (PAK6)	PF00786 ; PF00069	27.451 (56/204)	1.05E-11
Serine/threonine-protein kinase WNK4 (WNK4)	PF12202 ; PF00069	26.609 (62/233)	1.05E-11
Serine/threonine-protein kinase 35 (STK35)	PF00069	24.921 (79/317)	1.10E-11
Doublecortin-like kinase 2 (DCLK2)	PF03607 ; PF00069	25.651 (69/269)	3.52E-11
MAPK/ERK kinase kinase 3 (MAP3K3)	PF00564 ; PF00069	29.148 (65/223)	5.04E-11
Serine/threonine-protein kinase ICK (CILK1)	PF00069	28.436 (60/211)	5.78E-11
MEK kinase kinase 1 (MAP4K1)	PF00780 ; PF00069	31.604 (67/212)	7.85E-11
Serine/threonine-protein kinase 32C (STK32C)	PF00069	25.703 (64/249)	8.10E-11
NIMA-related kinase 1 (NEK1)	PF00069	23.221 (62/267)	1.02E-10
STE20-related serine/threonine-protein kinase (SLK)	PF00069 ; PF12474	27.053 (56/207)	1.19E-10
Myosin light kinase (MYLK)	PF16620 ; PF00041 ; PF07679 ; PF00069 More >>	23.894 (54/226)	1.28E-10
Calcium/calmodulin-dependent protein kinase type 1G (CAMK1G)	PF00069	23.932 (56/234)	1.66E-10
MEK kinase kinase 2 (MAP4K2)	PF00780 ; PF00069	27.751 (58/209)	1.89E-10
MAPK/ERK kinase kinase 2 (MAP3K2)	PF00564 ; PF00069	27.232 (61/224)	2.72E-10
Serine/threonine-protein kinase MARK2 (MARK2)	PF02149 ; PF00069 ; PF00627 More >>	24.893 (58/233)	2.85E-10
Serine/threonine-protein kinase WNK2 (WNK2)	PF12202 ; PF00069	28.372 (61/215)	3.30E-10
Serine/threonine-protein kinase WNK1 (WNK1)	PF12202 ; PF00069	26.728 (58/217)	3.49E-10
Ste-20-related kinase (STK39)	PF12202 ; PF00069	27.099 (71/262)	3.63E-10
Serine/threonine-protein kinase H1 (PSKH1)	PF00069	26.036 (44/169)	3.69E-10
Fused homolog (STK36)	PF13646 ; PF00069	25.424 (60/236)	3.83E-10
PAK-4 protein kinase (PAK4)	PF00786 ; PF00069	27.941 (57/204)	3.94E-10
Proto-oncogene serine/threonine-protein kinase mos (MOS)	PF00069	25.589 (76/297)	4.68E-10
Serine/threonine-protein kinase Nek8 (NEK8)	PF00069 ; PF00415	23.194 (61/263)	5.37E-10
Death-associated protein kinase 3 (DAPK3)	PF00069	28.161 (49/174)	5.39E-10
MST-1 protein kinase (STK4)	PF11629 ; PF00069	26.829 (55/205)	6.47E-10
Doublecortin-like kinase 1 (DCLK1)	PF03607 ; PF00069	25.391 (65/256)	6.61E-10
Serine/threonine-protein kinase PAK 5 (PAK5)	PF00786 ; PF00069	26.486 (49/185)	7.16E-10
TAO kinase 1 (TAOK1)	PF00069	27.700 (59/213)	7.18E-10
Omphalocele kinase 1 (NUAK1)	PF00069	24.793 (60/242)	7.24E-10
Cyclin-dependent kinase 13 (CDK13)	PF12330 ; PF00069	23.304 (79/339)	8.84E-10
MAPK/ERK kinase kinase 1 (MAP3K1)	PF00069	22.826 (63/276)	9.31E-10
WNK lysine-deficient protein kinase 3 (WNK3)	PF12202 ; PF00069	25.740 (87/338)	1.21E-09
NIMA-related kinase 2 (NEK2)	PF00069	26.577 (59/222)	1.35E-09
Serine/threonine-protein kinase D2 (PRKD2)	PF00130 ; PF00069	25.108 (58/231)	1.59E-09
Serine/threonine-protein kinase H2 (PSKH2)	PF00069	24.044 (44/183)	1.71E-09
Cyclin-dependent kinase 4 (CDK4)	PF00069	28.025 (44/157)	2.04E-09
Serine/threonine-protein kinase 33 (STK33)	PF00069	21.074 (102/484)	2.41E-09
Apoptosis signal-regulating kinase 1 (MAP3K5)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	26.718 (70/262)	2.53E-09
Cyclin-dependent kinase 12 (CDK12)	PF00069	25.676 (57/222)	2.57E-09
Microtubule affinity regulating kinase 3 (MARK3)	PF02149 ; PF00069 ; PF00627 More >>	25.214 (59/234)	3.44E-09
Doublecortin-like kinase 3 (DCLK3)	PF00069	25.824 (47/182)	3.62E-09
Dual specificity mitogen-activated protein kinase kinase 4 (MAP2K4)	PF00069	23.511 (75/319)	3.88E-09
Ribosomal protein S6 kinase beta-1 (S6K1)	PF00069 ; PF00433	23.506 (59/251)	4.02E-09
Receptor-interacting serine/threonine-protein kinase 3 (RIPK3)	PF00069 ; PF12721	25.217 (58/230)	4.26E-09
Yet another novel kinase 2 (STK32B)	PF00069	25.214 (59/234)	4.77E-09
Cytoplasmic DRAK1 (STK17A)	PF00069	25.828 (39/151)	4.82E-09
Protein kinase C eta type (PRKCH)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	23.457 (57/243)	5.58E-09
Serine/threonine-protein kinase 10 (STK10)	PF00069 ; PF12474	23.985 (65/271)	6.34E-09
Checkpoint kinase-1 (CHK1)	PF00069	25.368 (69/272)	7.24E-09
Extracellular signal-regulated kinase 5 (ERK5)	PF00069	24.790 (59/238)	8.60E-09
Death-associated protein kinase 1 (DAPK1)	PF00023 ; PF12796 ; PF13637 ; PF00531 ; PF00069 More >>	25.843 (46/178)	8.87E-09
Protein kinase C delta (PRKCD)	PF00130 ; PF00069 ; PF00433 More >>	25.455 (70/275)	9.68E-09
TBC domain-containing protein kinase-like protein (TBCK)	PF00069 ; PF00566 ; PF00581 More >>	21.519 (51/237)	1.03E-08
Calcium/calmodulin-dependent protein kinase type 1D (CAMK1D)	PF00069	21.941 (52/237)	1.15E-08
Serine/threonine-protein kinase MARK1 (MARK1)	PF02149 ; PF00069 ; PF00627 More >>	24.034 (56/233)	1.15E-08
Bone morphogenetic protein receptor (BMPR2)	PF01064 ; PF00069	26.230 (64/244)	1.44E-08
Cyclin-dependent kinase 6 (CDK6)	PF00069	24.082 (59/245)	1.45E-08
Serine/threonine-protein kinase 3 (STK3)	PF11629 ; PF00069	26.341 (54/205)	1.58E-08
ERK activator kinase 7 (MAP2K7)	PF00069	26.054 (68/261)	1.62E-08
Testis-specific serine kinase 2 (TSSK2)	PF00069	24.125 (62/257)	1.81E-08
MEK kinase kinase 3 (MAP4K3)	PF00780 ; PF00069	23.297 (65/279)	1.92E-08
Serine/threonine-protein kinase Chk2 (RAD53)	PF00498 ; PF00069	26.020 (51/196)	2.11E-08
Testis-specific serine/threonine-protein kinase 4 (TSSK4)	PF00069	25.417 (61/240)	2.14E-08
PDZ binding kinase (PBK)	PF00069	24.590 (60/244)	2.14E-08
Protein kinase N2 (PKN2)	PF02185 ; PF00069 ; PF00433 More >>	26.744 (69/258)	2.34E-08
Inhibitor of nuclear factor kappa-B kinase subunit epsilon (IKBKE)	PF00069 ; PF18394 ; PF18396 More >>	25.316 (60/237)	2.47E-08
Protein kinase D (PRKD1)	PF00130 ; PF00169 ; PF00069 More >>	24.569 (57/232)	2.51E-08
Ribosomal protein S6 kinase beta-2 (RPS6KB2)	PF00069 ; PF00433	22.530 (57/253)	2.55E-08
SNF-related serine/threonine-protein kinase (SNRK)	PF00069	24.354 (66/271)	2.99E-08
NF-kappa-B-activating kinase (TBK1)	PF00069 ; PF18394 ; PF18396 More >>	23.618 (47/199)	4.16E-08
Protein kinase N1 (PKN1)	PF02185 ; PF00069 ; PF00433 More >>	27.119 (80/295)	4.38E-08
Serine/threonine-protein kinase D3 (PRKD3)	PF00130 ; PF00169 ; PF00069 More >>	24.138 (56/232)	4.53E-08
Protein kinase C theta (PRKCQ)	PF00130 ; PF00069 ; PF00433 More >>	22.909 (63/275)	5.07E-08
IL-1 receptor-associated kinase 1 (IRAK1)	PF00531 ; PF00069	25.225 (56/222)	6.04E-08
MAPK/MAK/MRK overlapping kinase (MOK)	PF00069	29.464 (33/112)	6.37E-08
Cyclin-dependent kinase 15 (CDK15)	PF00069	25.455 (56/220)	7.74E-08
Leucine-rich repeat serine/threonine-protein kinase 1 (LRRK1)	PF12796 ; PF16095 ; PF00069 ; PF08477 More >>	25.751 (60/233)	9.15E-08
Putative serine/threonine-protein kinase PRKY (PRKY)	PF00069	22.348 (59/264)	1.01E-07
Cyclin-dependent kinase 3 (CDK3)	PF00069	25.000 (54/216)	1.29E-07
Calcium/calmodulin-dependent protein kinase type II subunit delta (CAMK2D)	PF08332 ; PF00069	24.583 (59/240)	1.33E-07
ERK activator kinase 5 (MAP2K5)	PF00564 ; PF00069	23.273 (64/275)	1.41E-07
Cyclin-dependent kinase-like 3 (CDKL3)	PF00069	25.854 (53/205)	1.50E-07
Serine/threonine-protein kinase NIM1 (NIM1K)	PF00069	23.420 (63/269)	1.61E-07
TAO kinase 3 (TAOK3)	PF00069	25.352 (72/284)	1.67E-07
Eukaryotic translation initiation factor 2-alpha kinase 1 (EIF2AK1)	PF00069	31.304 (36/115)	1.75E-07
MAP kinase signal-integrating kinase 2 (MKNK2)	PF00069	29.143 (51/175)	1.76E-07
Testis-specific serine/threonine-protein kinase 6 (TSSK6)	PF00069	25.701 (55/214)	1.84E-07
Cyclin-dependent kinase 11A (CDK11A)	PF00069	25.103 (61/243)	1.96E-07
Cyclin-G-associated kinase (GAK)	PF00069 ; PF10409	25.490 (78/306)	2.16E-07
Polo-like kinase 4 (PLK4)	PF00069 ; PF18190 ; PF18409 More >>	22.137 (58/262)	2.25E-07
Misshapen-like kinase 1 (MINK1)	PF00780 ; PF00069	22.685 (49/216)	2.36E-07
TRAF2 and NCK interacting kinase (TNIK)	PF00780 ; PF00069	23.041 (50/217)	2.43E-07
Mitogen-activated protein kinase 6 (MAPK6)	PF00069	26.500 (53/200)	2.81E-07
MAPK-activated protein kinase 3 (MAPKAPK3)	PF00069	23.973 (35/146)	3.04E-07
Polo-like kinase 2 (PLK2)	PF00069 ; PF00659	23.571 (66/280)	3.07E-07
Myosin light chain kinase family member 4 (MYLK4)	PF00069	21.368 (50/234)	3.35E-07
Cyclin-dependent kinase 11B (CDK11B)	PF00069	24.691 (60/243)	3.49E-07
Calcium/calmodulin-dependent protein kinase type IV (CAMK4)	PF00069	23.494 (39/166)	4.14E-07
Calcium/calmodulin-dependent protein kinase type 1 (CAMK1)	PF00069	22.368 (51/228)	4.42E-07
Cyclin-dependent kinase 1 (CDK1)	PF00069	25.592 (54/211)	4.49E-07
Death-associated protein kinase 2 (DAPK2)	PF00069	26.437 (46/174)	4.75E-07
MEK kinase kinase 4 (MAP4K4)	PF00780 ; PF00069	22.685 (49/216)	4.78E-07
Cyclin-dependent kinase 9 (CDK9)	PF00069	23.744 (52/219)	5.89E-07
Polo-like kinase 1 (PLK1)	PF00069 ; PF00659	23.574 (62/263)	7.16E-07
Calcium/calmodulin-dependent protein kinase type II subunit beta (CAMK2B)	PF08332 ; PF00069	23.288 (51/219)	7.25E-07
Protein kinase C alpha (PRKCA)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	21.790 (56/257)	7.28E-07
Mitogen-activated protein kinase kinase kinase kinase 5 (MAP4K5)	PF00780 ; PF00069	26.794 (56/209)	7.35E-07
Ribosomal protein S6 kinase alpha-4 (RPS6KA4)	PF00069 ; PF00433	24.889 (56/225)	7.43E-07
Aurora kinase B (AURKB)	PF00069	24.809 (65/262)	7.86E-07
cAMP-dependent protein kinase catalytic subunit PRKX (PRKX)	PF00069	20.930 (54/258)	8.06E-07
Endoplasmic reticulum to nucleus signaling 1 (ERN1)	PF00069 ; PF06479	25.632 (71/277)	8.13E-07
Microtubule-associated serine/threonine-protein kinase 3 (MAST3)	PF08926 ; PF17820 ; PF02163 ; PF00069 More >>	21.942 (61/278)	9.05E-07
Homeodomain-interacting protein kinase 1 (HIPK1)	PF00069	25.641 (60/234)	9.22E-07
Ribosomal protein S6 kinase alpha-5 (RSK5)	PF00069 ; PF00433	23.932 (56/234)	1.05E-06
Calcium/calmodulin-dependent protein kinase type II subunit gamma (CAMK2G)	PF08332 ; PF00069	22.634 (55/243)	1.09E-06
Protein kinase C epsilon (PRKCE)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	21.901 (53/242)	1.13E-06
NDR2 protein kinase (STK38L)	PF00069 ; PF00433	24.444 (66/270)	1.35E-06
MAPK/ERK kinase kinase 4 (MAP3K4)	PF19431 ; PF00069	22.340 (63/282)	1.49E-06
Titin (TTN)		23.243 (43/185)	1.67E-06
MAPK-activated protein kinase 2 (MAPKAPK2)	PF00069	25.362 (35/138)	1.74E-06
Dual-specificity tyrosine-phosphorylation regulated kinase 3 (DYRK3)	PF00069	25.911 (64/247)	1.76E-06
ERK activator kinase 2 (MEK2)	PF00069	26.699 (55/206)	1.77E-06
Beta-adrenergic receptor kinase 1 (ADRBK1)	PF00169 ; PF00069 ; PF00615 More >>	24.017 (55/229)	1.84E-06
Calmodulin-dependent kinase II (CAMKK2)	PF00069	29.310 (51/174)	2.12E-06
Serine/threonine-protein kinase 32A (STK32A)	PF00069	22.656 (58/256)	2.14E-06
Cyclin-dependent kinase 5 (CDK5)	PF00069	22.222 (52/234)	2.45E-06
Protein kinase N3 (PKN3)	PF02185 ; PF00069 ; PF00433 More >>	31.933 (38/119)	2.52E-06
Tau-tubulin kinase (TTBK1)	PF00069	22.041 (54/245)	3.38E-06
Striated muscle preferentially expressed protein kinase (SPEG)	PF07679 ; PF00069 ; PF16650 More >>	27.604 (53/192)	3.63E-06
Extracellular signal-regulated kinase 2 (ERK2)	PF00069	24.291 (60/247)	3.84E-06
RAC-gamma serine/threonine-protein kinase (AKT3)	PF00169 ; PF00069 ; PF00433 More >>	21.941 (52/237)	4.12E-06
Serine/threonine-protein kinase PLK3 (PLK3)	PF00069 ; PF00659	23.022 (64/278)	4.14E-06
Serine/threonine-protein kinase STK11 (STK11)	PF00069	24.549 (68/277)	4.44E-06
NDR1 protein kinase (STK38)	PF00069 ; PF00433	23.370 (43/184)	4.44E-06
Serine/threonine-protein kinase PDIK1L (PDIK1L)	PF00069	22.814 (60/263)	5.08E-06
Mitogen-activated protein kinase 4 (MAPK4)	PF00069	24.545 (54/220)	5.17E-06
Extracellular signal-regulated kinase 1 (ERK1)	PF00069	23.529 (56/238)	5.17E-06
Myosin-IIIb (MYO3B)	PF00612 ; PF00063 ; PF00069 More >>	25.112 (56/223)	5.40E-06
Homeodomain interacting protein kinase 2 (HIPK2)	PF00069	25.106 (59/235)	5.76E-06
cAMP-dependent protein kinase catalytic subunit gamma (PRKACG)	PF00069	23.265 (57/245)	6.10E-06
Beta-adrenergic receptor kinase 2 (ADRBK2)	PF00169 ; PF00069 ; PF00615 More >>	24.107 (54/224)	6.29E-06
Glycogen synthase kinase-3 beta (GSK-3B)	PF00069	27.706 (64/231)	6.86E-06
Nik-related protein kinase (NRK)	PF00780 ; PF00069	23.404 (55/235)	7.26E-06
Salt-inducible kinase 1 (SIK1)	PF00069	24.667 (74/300)	7.29E-06
Serine/threonine-protein kinase NLK (NLK)	PF00069	24.413 (52/213)	7.51E-06
Cyclin-dependent kinase-like 2 (CDKL2)	PF00069	25.877 (59/228)	7.55E-06
Microtubule-associated serine/threonine-protein kinase 4 (MAST4)	PF08926 ; PF17820 ; PF02163 ; PF00069 More >>	21.138 (52/246)	7.98E-06
Putative serine/threonine-protein kinase SIK1B (SIK1B)	PF00069	24.667 (74/300)	8.14E-06
Microtubule-associated serine/threonine-protein kinase 2 (MAST2)	PF08926 ; PF17820 ; PF00069 More >>	22.335 (44/197)	1.22E-05
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2)	PF16579 ; PF00069	22.936 (50/218)	1.38E-05
Hormonally up-regulated neu tumor-associated kinase (HUNK)	PF00069	23.364 (50/214)	1.42E-05
Protein kinase C gamma (PRKCG)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	25.828 (39/151)	1.45E-05
RAC-beta serine/threonine-protein kinase (AKT2)	PF00169 ; PF00069 ; PF00433 More >>	20.661 (50/242)	1.49E-05
Glycogen synthase kinase-3 alpha (GSK-3A)	PF00069	26.407 (61/231)	1.54E-05
Cyclin-dependent kinase 19 (CDK19)	PF00069	26.347 (44/167)	1.56E-05
Tyrosine-protein kinase EIF2AK2 (p68)	PF00035 ; PF00069	21.569 (44/204)	1.60E-05
SIK family kinase 3 (SIK3)	PF00069	24.521 (64/261)	1.64E-05
Protein kinase C beta (PRKCB)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	22.458 (53/236)	1.71E-05
RAC-alpha serine/threonine-protein kinase (AKT1)	PF00169 ; PF00069 ; PF00433 More >>	21.901 (53/242)	2.00E-05
Serine/threonine-protein kinase Sgk1 (SGK1)	PF00069 ; PF00433	19.763 (50/253)	2.03E-05
Homeodomain-interacting protein kinase 3 (HIPK3)	PF00069	23.887 (59/247)	2.08E-05
5'-AMP-activated protein kinase catalytic subunit alpha-1 (PRKAA1)	PF16579 ; PF00069	22.039 (67/304)	2.17E-05
Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2A)	PF08332 ; PF00069	23.207 (55/237)	2.27E-05
Cyclin-dependent kinase 8 (CDK8)	PF00069	25.455 (42/165)	2.45E-05
Cyclin-dependent kinase 20 (CDK20)	PF00069	25.743 (52/202)	2.57E-05
Serine/threonine-protein kinase Nek10 (NEK10)	PF00069	24.468 (69/282)	2.58E-05
Cyclin-dependent kinase-like 5 (CDKL5)	PF00069	25.339 (56/221)	2.98E-05
G protein-coupled receptor kinase 6 (GRK6)	PF00069 ; PF00615	26.163 (45/172)	3.53E-05
Cyclin-dependent kinase 10 (CDK10)	PF00069	23.750 (57/240)	4.29E-05
Serine/threonine-protein kinase SBK1 (SBK1)	PF00069	25.000 (55/220)	4.99E-05
Serine/threonine-protein kinase Kist (UHMK1)	PF00069 ; PF00076	25.000 (45/180)	5.07E-05
Activin receptor type IIB (ACVR2B)	PF01064 ; PF00069	23.975 (76/317)	5.17E-05
CDC-like kinase 3 (CLK3)	PF00069	23.950 (57/238)	5.50E-05
Protein kinase C iota (PRKCI)	PF00130 ; PF00564 ; PF00069 ; PF00433 More >>	19.926 (54/271)	5.64E-05
Eukaryotic translation initiation factor 2-alpha kinase 4 (EIF2AK4)	PF12745 ; PF00069 ; PF05773 ; PF13393 More >>	25.000 (33/132)	5.86E-05
Maternal embryonic leucine zipper kinase (MELK)	PF02149 ; PF00069	22.642 (60/265)	6.25E-05
G protein-coupled receptor kinase 5 (GRK5)	PF00069 ; PF00615	25.664 (58/226)	6.95E-05
Microtubule-associated serine/threonine-protein kinase 1 (MAST1)	PF08926 ; PF17820 ; PF00069 More >>	23.636 (39/165)	8.32E-05
Protein kinase G2 (PRKG2)	PF00027 ; PF00069	24.082 (59/245)	9.17E-05
Dual-specificity tyrosine-phosphorylation regulated kinase 2 (DYRK2)	PF00069	24.670 (56/227)	1.20E-04
G protein-coupled receptor kinase 4 (GRK4)	PF00069 ; PF00615	25.904 (43/166)	1.35E-04
BR serine/threonine kinase 1 (BRSK1)	PF00069	24.803 (63/254)	1.44E-04
Serine/threonine-protein kinase tousled-like 2 (TLK2)	PF00069	23.377 (54/231)	1.46E-04
Serine/threonine kinase-like domain-containing protein STKLD1 (STKLD1)	PF00069	25.472 (27/106)	1.74E-04
Homeodomain-interacting protein kinase 4 (HIPK4)	PF00069	24.893 (58/233)	1.85E-04
Peripheral plasma membrane protein CASK (CASK)	PF00625 ; PF02828 ; PF00595 ; PF00069 ; PF00018 More >>	25.263 (48/190)	2.15E-04
CaM-kinase IV kinase (CAMKK1)	PF00069	23.755 (62/261)	2.61E-04
Serine/threonine-protein kinase Sgk2 (SGK2)	PF00069 ; PF00433	19.828 (46/232)	3.54E-04
ERK activator kinase 1 (MEK1)	PF00069	27.972 (40/143)	3.56E-04
Calcium/calmodulin-dependent protein kinase type 1B (PNCK)	PF00069	22.269 (53/238)	3.68E-04
cAMP-dependent protein kinase catalytic subunit beta (PRKACB)	PF00069	22.845 (53/232)	3.92E-04
Tau-tubulin kinase 2 (TTBK2)	PF00069	23.009 (52/226)	4.03E-04
cAMP-dependent protein kinase catalytic subunit alpha (PRKACA)	PF00069	22.845 (53/232)	4.06E-04
Serine/threonine-protein kinase cot (COT)	PF00069	24.490 (48/196)	4.27E-04
Serine/threonine-protein kinase Sgk3 (SGK3)	PF00069 ; PF00433 ; PF00787 More >>	20.576 (50/243)	5.50E-04
Obscurin (OBSCN)	PF00041 ; PF07679 ; PF00612 ; PF00069 ; PF00621 More >>	27.119 (32/118)	6.64E-04
Stress-activated protein kinase 2a (p38 alpha)	PF00069	22.053 (58/263)	6.94E-04
Serine/threonine-protein kinase greatwall (MASTL)	PF00069	27.586 (48/174)	8.42E-04
BR serine/threonine kinase 2 (BRSK2)	PF00069	25.604 (53/207)	1.00E-03
Casein kinase I delta (CSNK1D)	PF00069	28.205 (33/117)	1.00E-03
STE20-related kinase adapter protein beta (STRADB)	PF00069	23.718 (74/312)	1.00E-03
Casein kinase I epsilon (CSNK1E)	PF00069	28.205 (33/117)	1.00E-03
Activin receptor type IB (ACVR1B)	PF01064 ; PF00069 ; PF08515 More >>	22.378 (64/286)	1.00E-03
Putative 3-phosphoinositide-dependent protein kinase 2 (PDPK2P)	PF00069	26.364 (29/110)	1.00E-03
Serine/threonine-protein kinase tousled-like 1 (TLK1)	PF00069	23.144 (53/229)	1.00E-03
Ribosomal protein S6 kinase-related protein (RSKR)	PF00069	31.183 (29/93)	1.00E-03
Dual specificity mitogen-activated protein kinase kinase 6 (MAP2K6)	PF00069	22.744 (63/277)	2.00E-03
Protein kinase C zeta (PRKCZ)	PF00130 ; PF00564 ; PF00069 ; PF00433 More >>	19.403 (65/335)	2.00E-03
Kalirin (KALRN)	PF13716 ; PF00041 ; PF07679 ; PF00169 ; PF00069 ; PF00621 ; PF16609 ; PF00435 More >>	24.419 (42/172)	3.00E-03
CDC-like kinase 4 (CLK4)	PF00069	23.438 (60/256)	3.00E-03
Serine/threonine-protein kinase NIK (MAP3K14)	PF00069	24.091 (53/220)	3.00E-03
Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3)	PF00069	22.420 (63/281)	4.00E-03
Protein kinase G1 (PRKG1)	PF00027 ; PF16808 ; PF00069 More >>	21.277 (50/235)	5.00E-03
Casein kinase I isoform alpha-like (CSNK1A1L)	PF00069	29.752 (36/121)	5.00E-03
Phosphoinositide dependent protein kinase-1 (PDPK1)	PF14593 ; PF00069	26.364 (29/110)	5.00E-03
Click to Show/Hide the Information of Human Similarity Proteins

Chemical Structure based Activity Landscape of Target

Top

Target Poor or Non Binders

Top

Target Poor or Non Binders

Target Poor or Non Binders Info

References

Top

REF 1

Design of potent and selective inhibitors to overcome clinical anaplastic lymphoma kinase mutations resistant to crizotinib. J Med Chem.> 2014 Feb 27;57(4):1170-87.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN