Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T48598
(Former ID: TTDNC00549)
|
|||||
Target Name |
GTPase KRas (KRAS)
|
|||||
Synonyms |
c-Ki-ras; c-K-ras; RASK2; Ki-Ras; KRAS2; K-Ras 2
Click to Show/Hide
|
|||||
Gene Name |
KRAS
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
Function |
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation. Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner.
Click to Show/Hide
|
|||||
BioChemical Class |
Small GTPase
|
|||||
UniProt ID | ||||||
Sequence |
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC VKIKKCIIM Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
HIT2.0 ID | T92ZDN |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
1 | AZD4785 | Drug Info | Phase 1 | Solid tumour/cancer | [1] | |
2 | BI 1701963 | Drug Info | Phase 1 | Solid tumour/cancer | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Inhibitor | [+] 2 Inhibitor drugs | + | ||||
1 | AZD4785 | Drug Info | [1] | |||
2 | BI 1701963 | Drug Info | [3] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Drug Binding Sites of Target | Top | |||||
---|---|---|---|---|---|---|
Ligand Name: Promazine | Ligand Info | |||||
Structure Description | The haddock model of GDP KRas in complex with promazine using chemical shift perturbations and intermolecular NOEs | PDB:7LGI | ||||
Method | Solution NMR | Resolution | N.A. | Mutation | No | [4] |
PDB Sequence |
MTEYKLVVVG
10 AGGVGKSALT20 IQLIQNHFVD30 EYDPTIEDSY40 RKQVVIDGET50 CLLDILDTAG 60 QEEYSAMRDQ70 YMRTGEGFLC80 VFAINNTKSF90 EDIHHYREQI100 KRVKDSEDVP 110 MVLVGNKCDL120 PSRTVDTKQA130 QDLARSYGIP140 FIETSAKTRQ150 GVDDAFYTLV 160 REIRKHKEK
|
|||||
|
||||||
Ligand Name: Benzimidazole | Ligand Info | |||||
Structure Description | Small-molecule ligands bind to a distinct pocket in Ras and inhibit SOS-mediated nucleotide exchange activity | PDB:4DSU | ||||
Method | X-ray diffraction | Resolution | 1.70 Å | Mutation | Yes | [5] |
PDB Sequence |
STEYKLVVVG
10 ADGVGKSALT20 IQLIQNHFVD30 EYDPTIEDSY40 RKQVVIDGET50 CLLDILDTAG 60 QSAMRDQYMR73 TGEGFLCVFA83 INNTKSFEDI93 HHYREQIKRV103 KDSEDVPMVL 113 VGNKCDLPSR123 TVDTKQAQDL133 ARSYGIPFIE143 TSAKTRQGVD153 DAFYTLVREI 163 RKHKEKMSKD173 GKKKKKK
|
|||||
|
||||||
Click to View More Binding Site Information of This Target with Different Ligands |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Tissue Distribution
of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.
The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects
(Nat Rev Drug Discov, 20: 64-81, 2021).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Tissue Distribution
Human Pathway Affiliation
Biological Network Descriptors
|
Note:
If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.
|
![](/ttd/sites/default/files/kegg_pathway/hsa04010-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04012-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04014-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04015-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04062-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04068-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04071-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04072-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04137-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04140-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04150-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04151-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04210-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04211-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04213-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04218-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04360-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04370-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04371-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04540-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04550-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04625-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04650-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04660-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04662-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04664-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04714-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04720-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04722-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04725-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04726-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04730-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04810-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04910-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04912-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04914-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04915-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04916-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04917-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04919-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04921-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04926-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04929-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04935-hsa3845.png)
![](/ttd/sites/default/files/kegg_pathway/hsa04960-hsa3845.png)
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
MAPK signaling pathway | hsa04010 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
ErbB signaling pathway | hsa04012 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Ras signaling pathway | hsa04014 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Rap1 signaling pathway | hsa04015 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Chemokine signaling pathway | hsa04062 | Affiliated Target |
![]() |
Class: Organismal Systems => Immune system | Pathway Hierarchy | ||
FoxO signaling pathway | hsa04068 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Sphingolipid signaling pathway | hsa04071 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Phospholipase D signaling pathway | hsa04072 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Mitophagy - animal | hsa04137 | Affiliated Target |
![]() |
Class: Cellular Processes => Transport and catabolism | Pathway Hierarchy | ||
Autophagy - animal | hsa04140 | Affiliated Target |
![]() |
Class: Cellular Processes => Transport and catabolism | Pathway Hierarchy | ||
mTOR signaling pathway | hsa04150 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
PI3K-Akt signaling pathway | hsa04151 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Apoptosis | hsa04210 | Affiliated Target |
![]() |
Class: Cellular Processes => Cell growth and death | Pathway Hierarchy | ||
Longevity regulating pathway | hsa04211 | Affiliated Target |
![]() |
Class: Organismal Systems => Aging | Pathway Hierarchy | ||
Longevity regulating pathway - multiple species | hsa04213 | Affiliated Target |
![]() |
Class: Organismal Systems => Aging | Pathway Hierarchy | ||
Cellular senescence | hsa04218 | Affiliated Target |
![]() |
Class: Cellular Processes => Cell growth and death | Pathway Hierarchy | ||
Axon guidance | hsa04360 | Affiliated Target |
![]() |
Class: Organismal Systems => Development and regeneration | Pathway Hierarchy | ||
VEGF signaling pathway | hsa04370 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Apelin signaling pathway | hsa04371 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Gap junction | hsa04540 | Affiliated Target |
![]() |
Class: Cellular Processes => Cellular community - eukaryotes | Pathway Hierarchy | ||
Signaling pathways regulating pluripotency of stem cells | hsa04550 | Affiliated Target |
![]() |
Class: Cellular Processes => Cellular community - eukaryotes | Pathway Hierarchy | ||
C-type lectin receptor signaling pathway | hsa04625 | Affiliated Target |
![]() |
Class: Organismal Systems => Immune system | Pathway Hierarchy | ||
Natural killer cell mediated cytotoxicity | hsa04650 | Affiliated Target |
![]() |
Class: Organismal Systems => Immune system | Pathway Hierarchy | ||
T cell receptor signaling pathway | hsa04660 | Affiliated Target |
![]() |
Class: Organismal Systems => Immune system | Pathway Hierarchy | ||
B cell receptor signaling pathway | hsa04662 | Affiliated Target |
![]() |
Class: Organismal Systems => Immune system | Pathway Hierarchy | ||
Fc epsilon RI signaling pathway | hsa04664 | Affiliated Target |
![]() |
Class: Organismal Systems => Immune system | Pathway Hierarchy | ||
Thermogenesis | hsa04714 | Affiliated Target |
![]() |
Class: Organismal Systems => Environmental adaptation | Pathway Hierarchy | ||
Long-term potentiation | hsa04720 | Affiliated Target |
![]() |
Class: Organismal Systems => Nervous system | Pathway Hierarchy | ||
Neurotrophin signaling pathway | hsa04722 | Affiliated Target |
![]() |
Class: Organismal Systems => Nervous system | Pathway Hierarchy | ||
Cholinergic synapse | hsa04725 | Affiliated Target |
![]() |
Class: Organismal Systems => Nervous system | Pathway Hierarchy | ||
Serotonergic synapse | hsa04726 | Affiliated Target |
![]() |
Class: Organismal Systems => Nervous system | Pathway Hierarchy | ||
Long-term depression | hsa04730 | Affiliated Target |
![]() |
Class: Organismal Systems => Nervous system | Pathway Hierarchy | ||
Regulation of actin cytoskeleton | hsa04810 | Affiliated Target |
![]() |
Class: Cellular Processes => Cell motility | Pathway Hierarchy | ||
Insulin signaling pathway | hsa04910 | Affiliated Target |
![]() |
Class: Organismal Systems => Endocrine system | Pathway Hierarchy | ||
GnRH signaling pathway | hsa04912 | Affiliated Target |
![]() |
Class: Organismal Systems => Endocrine system | Pathway Hierarchy | ||
Progesterone-mediated oocyte maturation | hsa04914 | Affiliated Target |
![]() |
Class: Organismal Systems => Endocrine system | Pathway Hierarchy | ||
Estrogen signaling pathway | hsa04915 | Affiliated Target |
![]() |
Class: Organismal Systems => Endocrine system | Pathway Hierarchy | ||
Melanogenesis | hsa04916 | Affiliated Target |
![]() |
Class: Organismal Systems => Endocrine system | Pathway Hierarchy | ||
Prolactin signaling pathway | hsa04917 | Affiliated Target |
![]() |
Class: Organismal Systems => Endocrine system | Pathway Hierarchy | ||
Thyroid hormone signaling pathway | hsa04919 | Affiliated Target |
![]() |
Class: Organismal Systems => Endocrine system | Pathway Hierarchy | ||
Oxytocin signaling pathway | hsa04921 | Affiliated Target |
![]() |
Class: Organismal Systems => Endocrine system | Pathway Hierarchy | ||
Relaxin signaling pathway | hsa04926 | Affiliated Target |
![]() |
Class: Organismal Systems => Endocrine system | Pathway Hierarchy | ||
GnRH secretion | hsa04929 | Affiliated Target |
![]() |
Class: Organismal Systems => Endocrine system | Pathway Hierarchy | ||
Growth hormone synthesis, secretion and action | hsa04935 | Affiliated Target |
![]() |
Class: Organismal Systems => Endocrine system | Pathway Hierarchy | ||
Aldosterone-regulated sodium reabsorption | hsa04960 | Affiliated Target |
![]() |
Class: Organismal Systems => Excretory system | Pathway Hierarchy | ||
Click to Show/Hide the Information of Affiliated Human Pathways |
Degree | 68 | Degree centrality | 7.31E-03 | Betweenness centrality | 2.23E-03 |
---|---|---|---|---|---|
Closeness centrality | 2.60E-01 | Radiality | 1.45E+01 | Clustering coefficient | 1.67E-01 |
Neighborhood connectivity | 3.95E+01 | Topological coefficient | 4.15E-02 | Eccentricity | 11 |
Download | Click to Download the Full PPI Network of This Target | ||||
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-interacting Proteins |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 2 | ClinicalTrials.gov (NCT04835714) A Study to Find a Safe and Effective Dose of BI 1701963 Alone and in Combination With BI 3011441 in Patients With Advanced Cancer and a Certain Mutation (KRAS). U.S. National Institutes of Health. | |||||
REF 3 | Clinical pipeline report, company report or official report of Boehringer Ingelheim. | |||||
REF 4 | Antipsychotic phenothiazine drugs bind to KRAS in vitro. J Biomol NMR. 2021 Jul;75(6-7):233-244. | |||||
REF 5 | Small-molecule ligands bind to a distinct pocket in Ras and inhibit SOS-mediated nucleotide exchange activity. Proc Natl Acad Sci U S A. 2012 Apr 3;109(14):5299-304. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.