Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T50444
(Former ID: TTDC00213)
|
|||||
| Target Name |
Connective tissue growth factor (CTGF)
|
|||||
| Synonyms |
Long; Insulin-like growth factor-binding protein 8; IGFBP8; IGFBP-8; IGF-binding protein 8; IBP-8; Hypertrophic chondrocyte-specific protein 24; HCS24; CCN2; CCN family member 2
Click to Show/Hide
|
|||||
| Gene Name |
CTGF
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 6 Target-related Diseases | + | ||||
| 1 | Idiopathic interstitial pneumonitis [ICD-11: CB03] | |||||
| 2 | Pancreatic cancer [ICD-11: 2C10] | |||||
| 3 | Schizoaffective disorder [ICD-11: 6A21] | |||||
| 4 | Schizophrenia [ICD-11: 6A20] | |||||
| 5 | Type 2 diabetes mellitus [ICD-11: 5A11] | |||||
| 6 | Chronic kidney disease [ICD-11: GB61] | |||||
| Function |
Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis. Major connective tissue mitoattractant secreted by vascular endothelial cells.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA AYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | Ocaperidone | Drug Info | Phase 2 | Schizoaffective disorder | [2], [3], [4] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | Ocaperidone | Drug Info | [5] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
| 1 | Hippo signaling pathway | |||||
| NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
| 1 | TGF_beta_Receptor Signaling Pathway | |||||
| PID Pathway | [+] 2 PID Pathways | + | ||||
| 1 | amb2 Integrin signaling | |||||
| 2 | TGF-beta receptor signaling | |||||
| Reactome | [+] 2 Reactome Pathways | + | ||||
| 1 | PPARA activates gene expression | |||||
| 2 | YAP1- and WWTR1 (TAZ)-stimulated gene expression | |||||
| WikiPathways | [+] 4 WikiPathways | + | ||||
| 1 | Hair Follicle Development: Cytodifferentiation (Part 3 of 3) | |||||
| 2 | Hair Follicle Development: Induction (Part 1 of 3) | |||||
| 3 | Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) | |||||
| 4 | YAP1- and WWTR1 (TAZ)-stimulated gene expression | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Cyr61/CTGF/Nov family proteins in gastric carcinogenesis. World J Gastroenterol. 2014 February 21; 20(7): 1694-1700. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 46). | |||||
| REF 3 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. | |||||
| REF 4 | Pharmacological profile of the new potent neuroleptic ocaperidone (R 79,598). J Pharmacol Exp Ther. 1992 Jan;260(1):146-59. | |||||
| REF 5 | Current and emerging drugs for idiopathic pulmonary fibrosis. Expert Opin Emerg Drugs. 2007 Nov;12(4):627-46. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.