Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T55936
(Former ID: TTDR00622)
|
|||||
| Target Name |
Mycobacterium CDP-diacylglycerol-inositol phosphatidyltransferase (MycB pssA)
|
|||||
| Synonyms |
pssA; PtdIns synthase; Phosphatidylinositol synthase; PI synthase
Click to Show/Hide
|
|||||
| Gene Name |
MycB pssA
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Alzheimer disease [ICD-11: 8A20] | |||||
| Function |
Catalyzes the biosynthesis of phosphatidylinositol (ptdins) as well as ptdins:inositol exchange reaction. May thus act to reduce an excessive cellular ptdins content. The exchange activity is due to the reverse reaction of ptdins synthase.
Click to Show/Hide
|
|||||
| BioChemical Class |
Kinase
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 2.7.8.8
|
|||||
| Sequence |
MIGKPRGRRGVNLQILPSAMTVLSICAGLTAIKFALEHQPKAAMALIAAAAILDGLDGRV
ARILDAQSRMGAEIDSLADAVNFGVTPALVLYVSMLSKWPVGWVVVLLYAVCVVLRLARY NALQDDGTQPAYAHEFFVGMPAPAGAVSMIGLLALKMQFGEGWWTSGWFLSFWVTGTSIL LVSGIPMKKMHAVSVPPNYAAALLAVLAICAAAAVLAPYLLIWVIIIAYMCHIPFAVRSQ RWLAQHPEVWDDKPKQRRAVRRASRRAHPYRPSMARLGLRKPGRRL Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | Myo-inositol | Drug Info | Phase 2 | Alzheimer disease | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 2 Inhibitor drugs | + | ||||
| 1 | Myo-inositol | Drug Info | [1] | |||
| 2 | Zn2+ | Drug Info | [1] | |||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Phosphatidylinositol synthesis in mycobacteria. Biochim Biophys Acta. 1999 Jan 4;1436(3):437-50. | |||||
| REF 2 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.