Target Information

Target General Information

Target ID

T57718 (Former ID: TTDI02217)

Target Name

Melanoma-associated antigen C2 (MAGEC2)

Synonyms

MAGEE1 antigen; MAGEE1; MAGEC2 antigen; MAGE-E1 antigen; MAGE-C2 antigen; Hepatocellular carcinomaassociated antigen 587; Hepatocellular carcinoma-associated antigen 587; HCA587; Cancer/testis antigen 10; CT10

Click to Show/Hide

Gene Name

MAGEC2

Target Type

Clinical trial target

[1]

Disease

[+] 1 Target-related Diseases

Lung cancer [ICD-11: 2C25]

Function

In vitro enhances ubiquitin ligase activity of TRIM28 and stimulates p53/TP53 ubiquitination in presence of Ubl-conjugating enzyme UBE2H leading to p53/TP53 degradation. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzymes (E2) at the E3:substrate complex. Proposed to enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases.

Click to Show/Hide

BioChemical Class

Melanoma associated antigen

UniProt ID

MAGC2_HUMAN

Sequence

MPPVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPSSFSTSSS
LILGGPEEEEVPSGVIPNLTESIPSSPPQGPPQGPSQSPLSSCCSSFSWSSFSEESSSQK
GEDTGTCQGLPDSESSFTYTLDEKVAELVEFLLLKYEAEEPVTEAEMLMIVIKYKDYFPV
ILKRAREFMELLFGLALIEVGPDHFCVFANTVGLTDEGSDDEGMPENSLLIIILSVIFIK
GNCASEEVIWEVLNAVGVYAGREHFVYGEPRELLTKVWVQGHYLEYREVPHSSPPYYEFL
WGPRAHSESIKKKVLEFLAKLNNTVPSSFPSWYKDALKDVEERVQATIDTADDATVMASE
SLSVMSSNVSFSE

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Drugs and Modes of Action

Top

Clinical Trial Drug(s)

[+] 1 Clinical Trial Drugs

CV-9201

Drug Info

Phase 1/2

Non-small-cell lung cancer

[2]

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues. The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021). Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database. The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017). Human Similarity Proteins Human Tissue Distribution Biological Network Descriptors

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.

The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021).

Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.

The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017).

Human Similarity Proteins

Human Tissue Distribution

Biological Network Descriptors

Protein Name	Pfam ID	Percentage of Identity (%)	E value
Melanoma-associated antigen C2 (MAGEC2)		100.000 (373/373)	0.00E+00
Cancer/testis antigen MAGE-C1/CT7 (MAGEC1)	PF01454	70.667 (159/225)	7.47E-98
Melanoma-associated antigen 10 (MAGEA10)	PF01454 ; PF12440	52.416 (141/269)	1.03E-86
Putative MAGE domain-containing protein MAGEA13P (MAGEA13P)	PF12440	45.455 (140/308)	3.04E-78
Melanoma-associated antigen B4 (MAGEB4)	PF01454 ; PF12440	45.270 (134/296)	1.28E-76
Melanoma-associated antigen B17 (MAGEB17)	PF01454 ; PF12440	45.183 (136/301)	6.14E-74
Melanoma-associated antigen B18 (MAGEB18)	PF01454 ; PF12440	45.172 (131/290)	1.01E-73
Melanoma-associated antigen 11 (MAGEA11)	PF01454 ; PF12440	47.212 (127/269)	2.28E-73
Melanoma-associated antigen B1 (MAGEB1)	PF01454 ; PF12440	44.014 (125/284)	1.41E-70
Melanoma-associated antigen C3 (MAGEC3)		50.916 (139/273)	3.29E-70
Melanoma-associated antigen B3 (MAGEB3)	PF01454 ; PF12440	44.444 (120/270)	7.48E-70
Melanoma-associated antigen B16 (MAGEB16)	PF01454 ; PF12440	52.582 (112/213)	8.20E-70
Melanoma-associated antigen 9 (MAGEA9; MAGEA9B)	PF12440	49.621 (131/264)	8.77E-70
Melanoma-associated antigen 4 (MAGEA4)	PF01454 ; PF12440	43.730 (136/311)	4.88E-69
Melanoma-associated antigen B10 (MAGEB10)	PF01454 ; PF12440	40.116 (138/344)	4.30E-67
Melanoma-associated antigen 8 (MAGEA8)	PF01454 ; PF12440	43.038 (136/316)	1.36E-65
Melanoma-associated antigen 3 (MAGEA3)	PF01454 ; PF12440	41.745 (134/321)	3.99E-65
Melanoma-associated antigen B2 (MAGEB2)	PF01454 ; PF12440	51.942 (107/206)	1.04E-62
Melanoma-associated antigen 12 (MAGEA12)	PF01454 ; PF12440	40.498 (130/321)	5.17E-62
Melanoma-associated antigen 6 (MAGEA6)	PF01454 ; PF12440	42.368 (136/321)	9.13E-60
Melanoma-associated antigen 1 (MAGEA1)	PF01454 ; PF12440	42.333 (127/300)	1.49E-56
Melanoma-associated antigen 2 (MAGEA2)	PF01454 ; PF12440	40.187 (129/321)	1.24E-55
Melanoma-associated antigen B5 (MAGEB5)	PF01454	42.130 (91/216)	2.72E-54
Non-structural maintenance of chromosomes element 3 homolog (NSMCE3)	PF01454	41.905 (88/210)	2.96E-53
Melanoma-associated antigen B6B (MAGEB6B)	PF01454 ; PF12440	37.918 (102/269)	3.15E-53
Melanoma-associated antigen B6 (MAGEB6)	PF01454 ; PF12440	42.105 (88/209)	1.36E-50
Melanoma-associated antigen D2 (MAGED2)	PF01454	37.811 (76/201)	2.39E-41
Melanoma-associated antigen E1 (MAGEE1)	PF01454	39.048 (82/210)	7.64E-41
Trophinin (TRO)	PF01454	38.350 (79/206)	7.61E-40
Melanoma-associated antigen D4 (MAGED4; MAGED4B)	PF01454	37.864 (78/206)	3.77E-39
Melanoma-associated antigen F1 (MAGEF1)	PF01454	40.000 (80/200)	8.37E-37
Necdin (NDN)	PF01454	31.295 (87/278)	1.46E-35
Melanoma-associated antigen D1 (MAGED1)	PF01454	39.487 (77/195)	1.64E-32
Melanoma-associated antigen E2 (MAGEE2)	PF01454	33.784 (75/222)	6.62E-31
Melanoma-associated antigen H1 (MAGEH1)	PF01454	42.857 (54/126)	1.04E-30
MAGE-like protein 2 (MAGEL2)	PF01454	39.024 (80/205)	2.34E-30
Putative melanoma-associated antigen 5P (MAGEA5P)	PF12440	36.842 (35/95)	1.51E-04
Click to Show/Hide the Information of Human Similarity Proteins


Note: If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.

Degree	1	Degree centrality	1.07E-04	Betweenness centrality	0.00E+00
Closeness centrality	1.94E-01	Radiality	1.33E+01	Clustering coefficient	0.00E+00
Neighborhood connectivity	2.40E+01	Topological coefficient	1.00E+00	Eccentricity	12
Download	Click to Download the Full PPI Network of This Target

Target Regulators

Top

Target-interacting Proteins

Target-interacting Proteins Info

Target Profiles in Patients

Top

Target Expression
Profile (TEP)

Target Expression Profile Info

References

Top

REF 1

National Cancer Institute Drug Dictionary (drug id 648549).

REF 2

ClinicalTrials.gov (NCT00923312) Trial of an RNActive-Derived Cancer Vaccine in Stage IIIB/IV Non Small Cell Lung Cancer (NSCLC). U.S. National Institutes of Health.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN