Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T68211
(Former ID: TTDNR00688)
|
|||||
| Target Name |
High mobility group protein HMG-I/Y (HMGA1)
|
|||||
| Synonyms |
High mobility group protein R; High mobility group protein HMG-I/HMG-Y; High mobility group protein A1; High mobility group AT-hook protein 1; HMGIY; HMG-I(Y)
|
|||||
| Gene Name |
HMGA1
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Function |
It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions. HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double-stranded DNA.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGR
PKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-interacting Proteins | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | HMG-I/Y, a new c-Myc target gene and potential oncogene. Mol Cell Biol. 2000 Aug;20(15):5490-502. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.