Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T83611
(Former ID: TTDS00471)
|
|||||
Target Name |
MHC class II antigen DRB1*1 (HLA-DRB1)
|
|||||
Synonyms |
HLA class II histocompatibility antigen, DRB1-1 beta chain; DR1; DR-1
Click to Show/Hide
|
|||||
Gene Name |
HLA-DRB1
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Multiple sclerosis [ICD-11: 8A40] | |||||
Function |
Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route; where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules; and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments; exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides; autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs; other cells of the gastrointestinal tract; such as epithelial cells; express MHC class II molecules and CD74 and act as APCs; which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen; three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs; CD74 undergoes a sequential degradation by various proteases; including CTSS and CTSL; leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells; the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules; increased acidification produces increased proteolysis and efficient peptide loading.
Click to Show/Hide
|
|||||
BioChemical Class |
MHC class II
|
|||||
UniProt ID | ||||||
Sequence |
MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYF
YNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTV QRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNG DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL FLGAGLFIYFRNQKGHSGLQPTGFLS Click to Show/Hide
|
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
1 | Glatiramer Acetate | Drug Info | Approved | Multiple sclerosis | [2], [3] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Binder | [+] 1 Binder drugs | + | ||||
1 | Glatiramer Acetate | Drug Info | [1] |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
PID Pathway | [+] 5 PID Pathways | + | ||||
1 | TCR signaling in naï | |||||
2 | ||||||
3 | IL12-mediated signaling events | |||||
4 | CXCR4-mediated signaling events | |||||
5 | IL12 signaling mediated by STAT4 | |||||
Reactome | [+] 6 Reactome Pathways | + | ||||
1 | Phosphorylation of CD3 and TCR zeta chains | |||||
2 | Translocation of ZAP-70 to Immunological synapse | |||||
3 | Generation of second messenger molecules | |||||
4 | MHC class II antigen presentation | |||||
5 | PD-1 signaling | |||||
6 | Interferon gamma signaling | |||||
WikiPathways | [+] 4 WikiPathways | + | ||||
1 | MHC class II antigen presentation | |||||
2 | TCR signaling | |||||
3 | Interferon gamma signaling | |||||
4 | Costimulation by the CD28 family |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Mechanism of action of glatiramer acetate in multiple sclerosis and its potential for the development of new applications. Proc Natl Acad Sci U S A. 2004 Oct 5;101 Suppl 2:14593-8. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1058). | |||||
REF 3 | The glatiramoid class of immunomodulator drugs. Expert Opin Pharmacother. 2009 Mar;10(4):657-68. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.