Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T83797
(Former ID: TTDC00194)
|
|||||
| Target Name |
Hepatocyte growth factor (HGF)
|
|||||
| Synonyms |
Scatter factor; SF; Hepatopoietin-A; Hepatopoeitin A; HPTA
|
|||||
| Gene Name |
HGF
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 4 Target-related Diseases | + | ||||
| 1 | Angina pectoris [ICD-11: BA40] | |||||
| 2 | Chronic arterial occlusive disease [ICD-11: BD4Z] | |||||
| 3 | Diabetic foot ulcer [ICD-11: BD54] | |||||
| 4 | Neuropathy [ICD-11: 8C0Z] | |||||
| Function |
Activating ligand for the receptor tyrosine kinase MET by binding to it and promoting its dimerization. Potent mitogen for mature parenchymal hepatocyte cells, seems to be a hepatotrophic factor, and acts as a growth factor for a broad spectrum of tissues and cell types.
Click to Show/Hide
|
|||||
| BioChemical Class |
Peptidase
|
|||||
| UniProt ID | ||||||
| Sequence |
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIK
TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTP HRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPL ETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGS ESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL DHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRD LKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLP NYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAG AEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII LTYKVPQS Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| ADReCS ID | BADD_A02005 | |||||
| HIT2.0 ID | T45X9Z | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 6 Clinical Trial Drugs | + | ||||
| 1 | Donaperminogene seltoplasmid | Drug Info | Phase 3 | Diabetic foot ulcer | [2] | |
| 2 | VM-202 | Drug Info | Phase 3 | Angina pectoris | [3] | |
| 3 | Ficlatuzumab | Drug Info | Phase 2 | Non-small-cell lung cancer | [4] | |
| 4 | MP0250 | Drug Info | Phase 1/2 | Non-small-cell lung cancer | [5] | |
| 5 | ABI-011 | Drug Info | Phase 1 | Solid tumour/cancer | [6] | |
| 6 | TAK-701 | Drug Info | Phase 1 | Advanced malignancy | [7] | |
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | Rilotumumab | Drug Info | Discontinued in Phase 2 | Grade IV malignant glioma | [8], [9] | |
| Mode of Action | [+] 3 Modes of Action | + | ||||
| Replacement | [+] 1 Replacement drugs | + | ||||
| 1 | Donaperminogene seltoplasmid | Drug Info | [10] | |||
| Modulator | [+] 2 Modulator drugs | + | ||||
| 1 | VM-202 | Drug Info | [1] | |||
| 2 | TAK-701 | Drug Info | [11] | |||
| Inhibitor | [+] 5 Inhibitor drugs | + | ||||
| 1 | Ficlatuzumab | Drug Info | [5] | |||
| 2 | MP0250 | Drug Info | [5] | |||
| 3 | ABI-011 | Drug Info | [5] | |||
| 4 | N,O6-Disulfo-Glucosamine | Drug Info | [14] | |||
| 5 | O2-Sulfo-Glucuronic Acid | Drug Info | [14] | |||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-interacting Proteins | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Therapeutic angiogenesis using naked DNA expressing two isoforms of the hepatocyte growth factor in a porcine acute myocardial infarction model. Eur J Cardiothorac Surg. 2008 Oct;34(4):857-63. | |||||
| REF 2 | ClinicalTrials.gov (NCT02563522) Safety and Efficacy Study of VM202 in the Treatment of Chronic Non-Healing Foot Ulcers. U.S. National Institutes of Health. | |||||
| REF 3 | ClinicalTrials.gov (NCT02427464) Phase 3 Gene Therapy for Painful Diabetic Neuropathy. U.S. National Institutes of Health. | |||||
| REF 4 | ClinicalTrials.gov (NCT02318368) A Phase 2, Multicenter, Study of Ficlatuzumab Plus Erlotinib Versus Placebo Plus Erlotinib in Subjects Who Have Previously Untreated Metastatic, EGFR-mutated Non-small Cell Lung Cancer (NSCLC) and BDX004 Positive Label. U.S. National Institutes of Health. | |||||
| REF 5 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 6 | ClinicalTrials.gov (NCT01163071) A Phase 1 Trial of ABI-011 in Patients With Advanced Solid Tumors or Lymphomas. U.S. National Institutes of Health. | |||||
| REF 7 | ClinicalTrials.gov (NCT00831896) Phase I Study of TAK-701 in Adult Patients With Advanced Nonhematological Malignancies. U.S. National Institutes of Health. | |||||
| REF 8 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7986). | |||||
| REF 9 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015060) | |||||
| REF 10 | Clinical pipeline report, company report or official report of ViroMed. | |||||
| REF 11 | Targeting MET in cancer: rationale and progress.Nat Rev Cancer.2012 Jan 24;12(2):89-103. | |||||
| REF 12 | Clinical pipeline report, company report or official report of Amgen (2009). | |||||
| REF 13 | AMG 102, a fully human anti-hepatocyte growth factor/scatter factor neutralizing antibody, enhances the efficacy of temozolomide or docetaxel in U-87 MG cells and xenografts. Clin Cancer Res. 2007 Nov 15;13(22 Pt 1):6735-42. | |||||
| REF 14 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.