Resistance mutation info of target
| Target General Information | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Target ID | T11843 | |||||||||||||||||
| Target Name | Vitamin K epoxide reductase complex subunit 1 (VKORC1) | |||||||||||||||||
| Gene Name | VKORC1 | |||||||||||||||||
| Species | Homo sapiens | |||||||||||||||||
| UniProt ID | VKOR1_HUMAN | |||||||||||||||||
| Sequence |
MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWG RGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYL AWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH [Homo sapiens] |
|||||||||||||||||
| Drug and Corresponding Resistance Mutations | ||||||||||||||||||
| Mutation Info | Missense: V66M | |||||||||||||||||
| Drugs |
|
|||||||||||||||||
|
||||||||||||||||||
| References | ||||||||||||||||||
| REF 1 | VKORC1 V66M mutation in African Brazilian patients resistant to oral anticoagulant therapy.Thromb Res.2010 Sep;126(3):e206-10. | |||||||||||||||||
| REF 2 | [Resistance to acenocoumarol revealing a missense mutation of the vitamin K epoxyde reductase VKORC1: a case report].Ann Cardiol Angeiol (Paris).2015 Feb;64(1):59-61. | |||||||||||||||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.