Target General Information |
Target ID |
T88240
|
Target Name |
Bacterial Hydroxymethyldihydropterin pyrophosphokinase-dihydropteroate synthase (DHPS) |
Gene Name |
folP |
Species |
Escherichia coli |
UniProt ID |
DHPS_ECOLI |
Sequence |
MKLFAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGE STRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKVGAHIINDIRSL SEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKE KLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIGQLLNVGPSERLSGSL ACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKENKRYE [Escherichia coli ]
|
Drug and Corresponding Resistance Mutations |
Mutation Info |
Missense: A587V |
Drugs |
Drug Name |
Sulfadiazine |
Drug Info
|
[2] |
Targeted Disease |
Toxoplasmosis |
|
Mutation Info |
Missense: F25I |
Drugs |
|
Mutation Info |
Missense: K540E |
Drugs |
Drug Name |
Sulfamethoxazole |
Drug Info
|
[1] |
Targeted Disease |
Plasmodium Falciparum Malaria |
|
Mutation Info |
Missense: K540N |
Drugs |
Drug Name |
Sulfamethoxazole |
Drug Info
|
[1] |
Targeted Disease |
Plasmodium Falciparum Malaria |
|
Mutation Info |
Missense: P55A |
Drugs |
Drug Name |
Dapsone |
Drug Info
|
[3] |
Targeted Disease |
Hansen disease |
|
Mutation Info |
Missense: P55H |
Drugs |
Drug Name |
Dapsone |
Drug Info
|
[3] |
Targeted Disease |
Hansen disease |
|
Mutation Info |
Missense: P55L |
Drugs |
Drug Name |
Dapsone |
Drug Info
|
[3] |
Targeted Disease |
Hansen disease |
|
Mutation Info |
Missense: P55R |
Drugs |
Drug Name |
Dapsone |
Drug Info
|
[3] |
Targeted Disease |
Hansen disease |
|
Mutation Info |
Missense: P55S |
Drugs |
Drug Name |
Dapsone |
Drug Info
|
[3] |
Targeted Disease |
Hansen disease |
|
Mutation Info |
Missense: P55T |
Drugs |
Drug Name |
Dapsone |
Drug Info
|
[3] |
Targeted Disease |
Hansen disease |
|
Mutation Info |
Missense: P64A |
Drugs |
|
Mutation Info |
Missense: P64H |
Drugs |
|
Mutation Info |
Missense: P64L |
Drugs |
|
Mutation Info |
Missense: P64R |
Drugs |
|
Mutation Info |
Missense: P64S |
Drugs |
|
Mutation Info |
Missense: T53A |
Drugs |
Drug Name |
Dapsone |
Drug Info
|
[3] |
Targeted Disease |
Hansen disease |
|
Mutation Info |
Missense: T53I |
Drugs |
Drug Name |
Dapsone |
Drug Info
|
[3] |
Targeted Disease |
Hansen disease |
|
Mutation Info |
Missense: T53N |
Drugs |
Drug Name |
Dapsone |
Drug Info
|
[3] |
Targeted Disease |
Hansen disease |
|
Mutation Info |
Missense: T53P |
Drugs |
Drug Name |
Dapsone |
Drug Info
|
[3] |
Targeted Disease |
Hansen disease |
|
References |
REF 1 |
Novel K540N mutation in Plasmodium falciparum dihydropteroate synthetase confers a lower level of sulfa drug resistance than does a K540E mutation. Antimicrob Agents Chemother. 2011 May;55(5):2481-2.
|
REF 2 |
In vitro susceptibility of various genotypic strains of Toxoplasma gondii to pyrimethamine, sulfadiazine, and atovaquone. Antimicrob Agents Chemother. 2008 Apr;52(4):1269-77.
|
REF 3 |
CARD 2017: expansion and model-centric curation of the comprehensive antibiotic resistance database. Nucleic Acids Res. 2017 Jan 4;45(D1):D566-D573.
|
REF 4 |
The comprehensive antibiotic resistance database. Antimicrob Agents Chemother. 2013 Jul;57(7):3348-57.
|