Resistance mutation info of drug

Drug General Information
Drug ID D0ML1F
Drug Name Adefovir Dipivoxil Drug Info
Synonyms Adefovirdipivoxl; Hepsera; Preveon; YouHeDing; Adefovir depivoxil; Adefovir pivoxil; GS 0840; GS 840;Piv2PMEA; Adefovir dipivoxil (USAN); Adefovir pivoxil (JAN); Bis(pom)PMEA; Bis-POM PMEA; GS-0840; GS-840; Hepsera (TM); Hepsera (TN); Preveon (TN); Bis(POM)-PMEA; Bis-POM PMEA, Adefovir Dipivoxil; Bis-POM PMEA, Preveon, Hepsera, Adefovir Dipivoxil; Bis(pivaloyloxymethyl)-9-(2-phosphonylmethoxyethyl)adenine; [2-(6-aminopurin-9-yl)ethoxymethyl-(2,2-dimethylpropanoyloxymethoxy)phosphoryl]oxymethyl 2,2-dimethylpropanoate; Propanoic acid,2,2-dimethyl-(((2-(6-amino-9H-purin-9-yl)ehtoxy)mehtyl)phosphinyldiene)bis(oxymehtylene)ester; Propanoic acid, 2,2-dimethyl-, (((2-(6-amino-9H-purin-9-yl)ethoxy)methyl)phosphinylidene)bis(oxymethylene) ester; (((2-(6-Amino-9H-purin-9-yl)ethoxy)methyl)phosphinylidene)bis(oxymethylene) 2,2-dimethylpropanoate; ((2-(6-Amino-9H-purin-9-yl)ethoxy)methyl)phosphonic acid, diester with hydroxymethyl pivalate; 9-(2-((-Bis((pivaloyloxy)methoxy)phosphinyl)methoxy)ethyl)adenine; 9-(2-((Bis((pivaloyloxy)methoxy)phosphinyl)methoxy)ethyl)adenine; ADV
Drug Type Small molecular drug
Therapeutic Class Antiviral Agents
Company Gilead Sciences
Structure D0ML1F
Drug Resistance Mutations
Target Name HBV Reverse transcriptase Target Info
Uniprot ID DPOL_HBVB5(347-690)
Species Hepatitis B virus genotype B (HBV-B)
Reference Sequence EDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNTRVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSR
IINNQHRTMQNLHNSCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLL
AQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYAAVTNFLLSLGIHLNPHKT
KRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQ [Hepatitis B vi
rus genotype B (HBV-B)]
Targeted Disease HBV infection
Drug Resistance Mutations
Mutation info Missense: M204V/I + T184 + S202 [556146]
Mutation info Missense: A181V [556006], [556146]
Mutation Prevalence 843 out of 11751 patients
Mutation info Missense: N236T [556006], [556146]
Mutation Prevalence 538 out of 11751 patients
References
Ref 536414Telbivudine: a new option for the treatment of chronic hepatitis B. Expert Opin Biol Ther. 2007 May;7(5):751-61.
Ref 556006Screening and identification of a novel adefovir dipivoxil resistance associated mutation, rtN236V, of HBV from a large cohort of HBV-infected patients. Antivir Ther. 2014;19(6):551-8. doi: 10.3851/IMP2775. Epub 2014 Apr 8.
Ref 556146Comparison of Detection Rate and Mutational Pattern of Drug-Resistant Mutations Between a Large Cohort of Genotype B and Genotype C Hepatitis B Virus-Infected Patients in North China. Microb Drug Resist. 2017 Jun;23(4):516-522. doi: 10.1089/mdr.2016.0093. Epub 2016 Oct 28.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.