Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T28722
|
||||
Former ID |
TTDI01774
|
||||
Target Name |
GABA A receptor
|
||||
Gene Name |
GABRG3
|
||||
Synonyms |
GABRG3
|
||||
Target Type |
Successful
|
||||
Disease | Anesthesia [ICD9: 338; ICD10: R20.0] | ||||
Anxiolytic and sedative [ICD10: F40-F42] | |||||
Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | |||||
Alzheimer disease [ICD9: 331; ICD10: G30] | |||||
Epileptic seizures [ICD9: 345.9, 780.3; ICD10: G40, P90, R56] | |||||
Epilepsy [ICD10: G40] | |||||
Generalized anxiety disorder [ICD9: 300, 300.02, 311; ICD10: F32, F40-F42, F41.1] | |||||
General anesthesia [ICD9: 338; ICD10: R20.0] | |||||
Insomnia [ICD9: 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F51.0, G47.0] | |||||
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | |||||
Neurodegenerative disease [ICD9: 330-337; ICD10: G30-G32] | |||||
Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0] | |||||
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
Premenstrual syndrome [ICD10: N94.3] | |||||
Panic disorder [ICD9: 300.01, 300.21; ICD10: F41.0] | |||||
Stroke [ICD9: 434.91, 437.6, 453, 671.5, 671.9; ICD10: I61-I63, I80-I82] | |||||
Sedation [ICD9: 338; ICD10: R52, G89] | |||||
Unspecified [ICD code not available] | |||||
Function |
Component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the vertebrate brain. Functions also as histamine receptor and mediates cellular responses to histamine. Functionsas receptor for diazepines and various anesthetics, such as pentobarbital; these are bound at a separate allosteric effector binding site. Functions as ligand- gated chloride channel (By similarity).
|
||||
BioChemical Class |
Ligand-gated ion channel
|
||||
UniProt ID | |||||
Sequence |
MAPKLLLLLCLFSGLHARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYDK
KLRPDIGIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNS NMVGLIWIPDTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPM DEHSCPLIFSSYGYPKEEMIYRWRKNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDY VVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLS TIARKSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYYSSCRKPTTTKKTTSLLHPDS SRWIPERISLQAPSNYSLLDMRPPPTAMITLNNSVYWQEFEDTCVYECLDGKDCQSFFCC YEECKSGSWRKGRIHIDILELDSYSRVFFPTSFLLFNLVYWVGYLYL |
||||
Drugs and Mode of Action | |||||
Drug(s) | Bentazepam | Drug Info | Approved | Anxiety disorder | [551871] |
Clobazam - Lundbeck | Drug Info | Approved | Unspecified | [551871] | |
Etomidate | Drug Info | Approved | Anesthesia | [536300], [540865] | |
Mebutamate | Drug Info | Approved | Anxiolytic and sedative | [551871] | |
Metharbital | Drug Info | Approved | Epilepsy | [538407], [542246] | |
Stiripentol | Drug Info | Approved | Epilepsy | [528174], [540871] | |
Talbutal | Drug Info | Approved | Sedation | [538418] | |
Thiamylal | Drug Info | Approved | Anesthesia | [542327], [550765] | |
Clomethiazole | Drug Info | Phase 3 | Stroke | [525101] | |
Remimazolam | Drug Info | Phase 3 | Anesthesia | [525292], [543138] | |
Pagoclone | Drug Info | Phase 2/3 | Anxiety disorder | [522559] | |
Etazolate | Drug Info | Phase 2 | Neurodegenerative disease | [529410], [542359] | |
EVT-201 | Drug Info | Phase 2 | Insomnia | [521889] | |
SARIPIDEM | Drug Info | Phase 2 | Anxiety disorder | [525986] | |
T-2007 | Drug Info | Phase 2 | Epilepsy | [522725] | |
AZD-3043 | Drug Info | Phase 1 | Anesthesia | [522974] | |
NSD-788 | Drug Info | Phase 1 | Anxiety disorder | [548723] | |
Org-25435 | Drug Info | Phase 1 | Epilepsy | [522942] | |
RWJ-51204 | Drug Info | Preclinical | Anxiety disorder | [547383] | |
Suriclone | Drug Info | Discontinued in Preregistration | Anxiety disorder | [544682] | |
Ocinaplon | Drug Info | Discontinued in Phase 3 | Generalized anxiety disorder | [467614], [544880] | |
PAZINACLONE | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [544719] | |
Y-23684 | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [544030] | |
LORECLEZOLE | Drug Info | Discontinued in Phase 2 | Epileptic seizures | [540868], [546397] | |
NGD 91-3 | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [546952] | |
RESEQUINIL | Drug Info | Discontinued in Phase 2 | Epilepsy | [546863] | |
RO-48-6791 | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [546337] | |
SL-65.1498 | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [547275] | |
Suritozole | Drug Info | Discontinued in Phase 2 | Major depressive disorder | [544851] | |
CCD-3693 | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [546165] | |
CTP-354 | Drug Info | Discontinued in Phase 1 | Pain | [549484] | |
Org-21465 | Drug Info | Discontinued in Phase 1 | Anesthesia | [546127] | |
RO-48-8684 | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [546340] | |
Co-152791 | Drug Info | Terminated | Epilepsy | [546908] | |
Girisopam | Drug Info | Terminated | Anxiety disorder | [545943] | |
NSD-721 | Drug Info | Terminated | Anxiety disorder | [546776] | |
Ro-15-3505 | Drug Info | Terminated | Discovery agent | [546017] | |
Ro-19-8022 | Drug Info | Terminated | Anxiety disorder | [544933] | |
RU-33965 | Drug Info | Terminated | Alzheimer disease | [544965] | |
ZK-91296 | Drug Info | Terminated | Alzheimer disease | [544676] | |
ZK-93426 | Drug Info | Terminated | Alzheimer disease | [467684], [544909] | |
Modulator | AA-29504 | Drug Info | [543814] | ||
AZD-3043 | Drug Info | [531883] | |||
Bentazepam | Drug Info | [530960], [551871] | |||
C-21191 | Drug Info | [543814] | |||
CCD-3693 | Drug Info | [1572591] | |||
Clobazam - Lundbeck | Drug Info | [556264] | |||
Clomethiazole | Drug Info | ||||
Co-152791 | Drug Info | [534715] | |||
CP-409092 | Drug Info | [1572605] | |||
CTP-354 | Drug Info | [550561] | |||
DOV-51892 | Drug Info | [543814] | |||
Etazolate | Drug Info | [529410] | |||
Etomidate | Drug Info | [556264] | |||
EVT-201 | Drug Info | [543814] | |||
GIDAZEPAM | Drug Info | [525609] | |||
Girisopam | Drug Info | ||||
HZ-166 | Drug Info | [543814] | |||
LORECLEZOLE | Drug Info | [534346] | |||
Mebutamate | Drug Info | [556264] | |||
Metharbital | Drug Info | [556264] | |||
NGD 96-3 | Drug Info | [543814] | |||
NSD-721 | Drug Info | [543814] | |||
NSD-788 | Drug Info | [543814] | |||
Ocinaplon | Drug Info | [531560] | |||
Org-21465 | Drug Info | [534520] | |||
Org-25435 | Drug Info | [530997] | |||
Pagoclone | Drug Info | [528204] | |||
PAZINACLONE | Drug Info | [536090] | |||
PNU 101017 | Drug Info | ||||
Ro-15-3505 | Drug Info | ||||
Ro-19-8022 | Drug Info | ||||
RO-48-6791 | Drug Info | [534517] | |||
RO-48-8684 | Drug Info | [534518] | |||
RU-33965 | Drug Info | [526780] | |||
RWJ-51204 | Drug Info | [526442] | |||
SARIPIDEM | Drug Info | [525986] | |||
Short-acting etomidate analogue | Drug Info | [543814] | |||
Stiripentol | Drug Info | [528174], [551871] | |||
Suriclone | Drug Info | [553196] | |||
Suritozole | Drug Info | [533581] | |||
Talbutal | Drug Info | [556264] | |||
Thiamylal | Drug Info | [556264] | |||
UC-2024 | Drug Info | [543814] | |||
UC-2029 | Drug Info | [543814] | |||
Y-23684 | Drug Info | [533803] | |||
ZK-91296 | Drug Info | ||||
ZK-93426 | Drug Info | ||||
Modulator (allosteric modulator) | alpha3IA | Drug Info | [543814] | ||
alpha5IA | Drug Info | [543814] | |||
DMCM | Drug Info | [543814] | |||
tetrahydrodeoxycorticosterone | Drug Info | [543814] | |||
TP003 | Drug Info | [543814] | |||
[11C]flumazenil | Drug Info | [543814] | |||
[18F]fluoroethylflumazenil | Drug Info | [543814] | |||
[3H]CGS8216 | Drug Info | [543814] | |||
[3H]Ro154513 | Drug Info | [543814] | |||
[3H]zolpidem | Drug Info | [543814] | |||
Agonist | isonipecotic acid | Drug Info | [543814] | ||
JM-1232(-) | Drug Info | [543814] | |||
NGD 91-3 | Drug Info | [526675] | |||
piperidine-4-sulphonic acid | Drug Info | [543814] | |||
Remimazolam | Drug Info | [531293] | |||
RESEQUINIL | Drug Info | [550144] | |||
SL-65.1498 | Drug Info | [550122] | |||
T-2007 | Drug Info | [543814] | |||
[3H]muscimol | Drug Info | [543814] | |||
Blocker (channel blocker) | TBPS | Drug Info | [543814] | ||
[35S]TBPS | Drug Info | [543814] | |||
Antagonist | UC-1011 | Drug Info | [543814] | ||
Pathways | |||||
KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
Retrograde endocannabinoid signaling | |||||
GABAergic synapse | |||||
Morphine addiction | |||||
Nicotine addiction | |||||
Reactome | Ligand-gated ion channel transport | ||||
GABA A receptor activation | |||||
WikiPathways | SIDS Susceptibility Pathways | ||||
Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | |||||
Iron uptake and transport | |||||
References | |||||
Ref 467614 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4277). | ||||
Ref 467684 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4347). | ||||
Ref 521889 | ClinicalTrials.gov (NCT00380003) Efficacy Study of EVT 201 to Treat Insomnia. U.S. National Institutes of Health. | ||||
Ref 522559 | ClinicalTrials.gov (NCT00830154) A Study to Assess the Efficacy and Safety of Pagoclone for Adults With Stuttering. U.S. National Institutes of Health. | ||||
Ref 522725 | ClinicalTrials.gov (NCT00939653) T2007-002 Clofarabine, Etoposide, Cyclophosphamide in Relapsed Acute Myelogenous Leukemia (AML). U.S. National Institutes of Health. | ||||
Ref 522942 | ClinicalTrials.gov (NCT01062867) First Administration to Man Of Org 25435 a New Intravenous Anesthetic. U.S. National Institutes of Health. | ||||
Ref 522974 | ClinicalTrials.gov (NCT01086813) Phase I, Single Centre, Study to Assess Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of AZD3043. U.S. National Institutes of Health. | ||||
Ref 525101 | ClinicalTrials.gov (NCT02374567) Pharmacovigilance in Gerontopsychiatric Patients. U.S. National Institutes of Health. | ||||
Ref 525292 | ClinicalTrials.gov (NCT02523859) Study Evaluating the Efficacy and Safety of Remimazolam in General Anesthesia in Adult Patients Undergoing Cardiac Surgery. | ||||
Ref 525986 | Behavioural effects of novel benzodiazepine (omega) receptor agonists and partial agonists: increases in punished responding and antagonism of the pentylenetetrazole cue. Behav Pharmacol. 1995 Mar;6(2):116-126. | ||||
Ref 528174 | Stiripentol, a putative antiepileptic drug, enhances the duration of opening of GABA-A receptor channels. Epilepsia. 2006 Apr;47(4):704-16. | ||||
Ref 529410 | Etazolate, a neuroprotective drug linking GABA(A) receptor pharmacology to amyloid precursor protein processing. J Neurochem. 2008 Jul;106(1):392-404. | ||||
Ref 536300 | Anaesthetic drugs: linking molecular actions to clinical effects. Curr Pharm Des. 2006;12(28):3665-79. | ||||
Ref 538407 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 008322. | ||||
Ref 538418 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 009410. | ||||
Ref 540865 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5463). | ||||
Ref 540868 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5466). | ||||
Ref 540871 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5469). | ||||
Ref 542246 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7230). | ||||
Ref 542327 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7305). | ||||
Ref 542359 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7336). | ||||
Ref 543138 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8442). | ||||
Ref 544030 | The pharmacological properties of Y-23684, a benzodiazepine receptor partial agonist.. Br J Pharmacol. 1994 April; 111(4): 1170-1178. | ||||
Ref 544676 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000552) | ||||
Ref 544682 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000574) | ||||
Ref 544719 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000717) | ||||
Ref 544851 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001322) | ||||
Ref 544880 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001407) | ||||
Ref 544909 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001474) | ||||
Ref 544933 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001584) | ||||
Ref 544965 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001729) | ||||
Ref 545943 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005437) | ||||
Ref 546017 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005900) | ||||
Ref 546127 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006459) | ||||
Ref 546165 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006723) | ||||
Ref 546337 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007556) | ||||
Ref 546340 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007572) | ||||
Ref 546397 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007906) | ||||
Ref 546776 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010233) | ||||
Ref 546863 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010724) | ||||
Ref 546908 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011029) | ||||
Ref 546952 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011480) | ||||
Ref 547275 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014726) | ||||
Ref 547383 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015754) | ||||
Ref 548723 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028006) | ||||
Ref 525609 | Discriminative effects of phenazepam and gidazepam in rats: comparison with other GABA-related drugs. Pharmacol Biochem Behav. 1999 Oct;64(2):397-401. | ||||
Ref 525986 | Behavioural effects of novel benzodiazepine (omega) receptor agonists and partial agonists: increases in punished responding and antagonism of the pentylenetetrazole cue. Behav Pharmacol. 1995 Mar;6(2):116-126. | ||||
Ref 526442 | 5-ethoxymethyl-7-fluoro-3-oxo-1,2,3,5-tetrahydrobenzo[4,5]imidazo[1,2a]pyridine-4-N-(2-fluorophenyl)carboxamide (RWJ-51204), a new nonbenzodiazepine anxiolytic. J Pharmacol Exp Ther. 2002 Nov;303(2):777-90. | ||||
Ref 526675 | Anxioselective compounds acting at the GABA(A) receptor benzodiazepine binding site. Curr Drug Targets CNS Neurol Disord. 2003 Aug;2(4):213-32. | ||||
Ref 526780 | Discriminative stimulus properties of RU 33965, a benzodiazepine receptor weak partial inverse agonist. Pharmacol Biochem Behav. 1992 Oct;43(2):583-8. | ||||
Ref 528174 | Stiripentol, a putative antiepileptic drug, enhances the duration of opening of GABA-A receptor channels. Epilepsia. 2006 Apr;47(4):704-16. | ||||
Ref 528204 | Evaluation of the abuse potential of pagoclone, a partial GABAA agonist. J Clin Psychopharmacol. 2006 Jun;26(3):268-73. | ||||
Ref 529410 | Etazolate, a neuroprotective drug linking GABA(A) receptor pharmacology to amyloid precursor protein processing. J Neurochem. 2008 Jul;106(1):392-404. | ||||
Ref 530960 | Prodynorphin gene deletion increased anxiety-like behaviours, impaired the anxiolytic effect of bromazepam and altered GABAA receptor subunits gene expression in the amygdala. J Psychopharmacol. 2011Jan;25(1):87-96. | ||||
Ref 530997 | First administration to man of Org 25435, an intravenous anaesthetic: A Phase 1 Clinical Trial. BMC Anesthesiol. 2010 Jun 29;10:10. | ||||
Ref 531293 | Remimazolam, a short-acting GABA(A) receptor agonist for intravenous sedation and/or anesthesia in day-case surgical and non-surgical procedures. IDrugs. 2010 Dec;13(12):929-37. | ||||
Ref 531560 | Discriminative stimulus properties of GABAA receptor positive allosteric modulators TPA023, ocinaplon and NG2-73 in rats trained to discriminate chlordiazepoxide or zolpidem. Eur J Pharmacol. 2011 Oct 1;668(1-2):190-3. | ||||
Ref 531883 | AZD-3043: a novel, metabolically labile sedative-hypnotic agent with rapid and predictable emergence from hypnosis. Anesthesiology. 2012 Jun;116(6):1267-77. | ||||
Ref 533581 | Chronic postinjury administration of MDL 26,479 (Suritozole), a negative modulator at the GABAA receptor, and cognitive impairment in rats following traumatic brain injury. J Neurosurg. 1995 Nov;83(5):878-83. | ||||
Ref 533803 | The pharmacological properties of Y-23684, a benzodiazepine receptor partial agonist. Br J Pharmacol. 1994 Apr;111(4):1170-8. | ||||
Ref 534346 | Direct activation of GABAA receptors by loreclezole, an anticonvulsant drug with selectivity for the beta-subunit. Neuropharmacology. 1996;35(12):1753-60. | ||||
Ref 534517 | Integrated pharmacokinetics and pharmacodynamics of Ro 48-6791, a new benzodiazepine, in comparison with midazolam during first administration to healthy male subjects. Br J Clin Pharmacol. 1997 Nov;44(5):477-86. | ||||
Ref 534518 | Integrated pharmacokinetics and pharmacodynamics of Ro 48-8684, a new benzodiazepine, in comparison with midazolam during first administration to healthy male subjects. Br J Clin Pharmacol. 1997 Nov;44(5):487-93. | ||||
Ref 534520 | Computer-controlled infusion of ORG 21465, a water soluble steroid i.v. anaesthetic agent, into human volunteers. Br J Anaesth. 1997 Oct;79(4):433-9. | ||||
Ref 534715 | Substituted 3beta-phenylethynyl derivatives of 3alpha-hydroxy-5alpha-pregnan-20-one: remarkably potent neuroactive steroid modulators of gamma-aminobutyric acidA receptors. J Pharmacol Exp Ther. 1998Oct;287(1):198-207. | ||||
Ref 536090 | The benzodiazepine binding site of GABA(A) receptors as a target for the development of novel anxiolytics. Expert Opin Investig Drugs. 2005 May;14(5):601-18. | ||||
Ref 543814 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 415). | ||||
Ref 550122 | WO patent application no. 2005,0749,31, Pharmaceutical combinations comprising (s) -pantoprazole. | ||||
Ref 551871 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
Ref 553196 | The effect of cyclopyrrolones on GABAA receptor function is different from that of benzodiazepines. Naunyn Schmiedebergs Arch Pharmacol. 1994 Sep;350(3):294-300. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.