Target Information

Target General Infomation
Target ID
T44282
Former ID
TTDR01185
Target Name
Aldehyde dehydrogenase, mitochondrial
Gene Name
ALDH2
Synonyms
ALDH class 2; ALDH-E2; ALDHI; Aldehyde dehydrogenase; Humanliver mitochondrial aldehyde dehydrogenase; Mitochondrial aldehyde dehydrogenase; ALDH2
Target Type
Clinical Trial
Disease Alcohol use disorders [ICD9: 303; ICD10: F10.2]
Cerebrovascular ischaemia [ICD9: 434.91; ICD10: I61-I63]
Substance dependence [ICD10: F10-F19]
BioChemical Class
Oxidoreductases acting on aldehyde or oxo group of donors
Target Validation
T44282
UniProt ID
P05091
EC Number
EC 1.2.1.3
Sequence
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Drugs and Mode of Action
Drug(s) ALD-401 Drug Info Phase 2 Cerebrovascular ischaemia [523318]
GS-6637 Drug Info Phase 1 Substance dependence [549559]
Daidzin Drug Info Terminated Discovery agent [546409]
Modulator ALD-401 Drug Info [531660]
Inhibitor Crotonaldehyde Drug Info [551393]
Daidzin Drug Info [551393]
GS-6637 Drug Info [531635], [550813]
ISOFORMONENTIN Drug Info [529588]
Nicotinamide-Adenine-Dinucleotide Drug Info [551393]
prunetin Drug Info [529588]
Antagonist CVT-10216 Drug Info [543653]
Pathways
KEGG Pathway Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of antibiotics
PathWhiz Pathway Beta-Alanine Metabolism
Ethanol Degradation
Histidine Metabolism
Valine, Leucine and Isoleucine Degradation
Pyruvate Metabolism
Oxidation of Branched Chain Fatty Acids
Glycine and Serine Metabolism
Tryptophan Metabolism
WikiPathways Tryptophan metabolism
Fatty Acid Omega Oxidation
Phase 1 - Functionalization of compounds
Neurotransmitter Clearance In The Synaptic Cleft
References
Ref 523318ClinicalTrials.gov (NCT01273337) Study of ALD-401 Via Intracarotid Infusion in Ischemic Stroke Subjects. U.S. National Institutes of Health.
Ref 546409Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007965)
Ref 549559Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800040688)
Ref 529588J Med Chem. 2008 Aug 14;51(15):4482-7. Epub 2008 Jul 10.Structure of daidzin, a naturally occurring anti-alcohol-addiction agent, in complex with human mitochondrial aldehyde dehydrogenase.
Ref 531635Therapeutic target database update 2012: a resource for facilitating target-oriented drug discovery. Nucleic Acids Res. 2012 Jan;40(Database issue):D1128-36.
Ref 531660A novel aldehyde dehydrogenase-3 activator leads to adult salivary stem cell enrichment in vivo. Clin Cancer Res. 2011 Dec 1;17(23):7265-72.
Ref 543653(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2595).
Ref 550813Clinical pipeline report, company report or official report of Gilead.
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.