Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T13251
|
||||
Former ID |
TTDC00033
|
||||
Target Name |
Interleukin-12
|
||||
Gene Name |
IL12A
|
||||
Synonyms |
CLMF p35; Cytotoxic lymphocyte maturation factor 35 kDa subunit; IL-12; NK cell stimulatory factor; NKSF; IL12A
|
||||
Target Type |
Successful
|
||||
Disease | Crohn's disease; Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51] | ||||
Crohn's disease; Moderate-to-severe rheumatoid arthritis [ICD9:555, 714; ICD10: K50, M05-M06] | |||||
Moderate-to-severe plaque psoriasis [ICD9: 696; ICD10: L40] | |||||
Psoriasis [ICD9: 696; ICD10: L40] | |||||
Function |
Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine- activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC.
|
||||
BioChemical Class |
Cytokine: interleukin
|
||||
Target Validation |
T13251
|
||||
UniProt ID | |||||
Sequence |
MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLE
FYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMM ALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQK SSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS |
||||
Drugs and Mode of Action | |||||
Drug(s) | Ustekinumab | Drug Info | Approved | Moderate-to-severe plaque psoriasis | [530677], [541942] |
Ustekinumab | Drug Info | Phase 3 | Psoriasis | [530677], [541942] | |
Ustekinumab | Drug Info | Phase 2/3 | Crohn's disease; Inflammatory bowel disease | [530677], [541942] | |
STA-5326 | Drug Info | Phase 2 | Crohn's disease; Moderate-to-severe rheumatoid arthritis | [528277], [536054] | |
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
Toll-like receptor signaling pathway | |||||
RIG-I-like receptor signaling pathway | |||||
Jak-STAT signaling pathway | |||||
Type I diabetes mellitus | |||||
Pertussis | |||||
Legionellosis | |||||
Leishmaniasis | |||||
Chagas disease (American trypanosomiasis) | |||||
African trypanosomiasis | |||||
Malaria | |||||
Toxoplasmosis | |||||
Amoebiasis | |||||
Tuberculosis | |||||
Measles | |||||
Influenza A | |||||
Herpes simplex infection | |||||
Inflammatory bowel disease (IBD) | |||||
Allograft rejection | |||||
Pathway Interaction Database | IL27-mediated signaling events | ||||
IL12-mediated signaling events | |||||
WikiPathways | Toll-like receptor signaling pathway | ||||
Aryl Hydrocarbon Receptor Pathway | |||||
Allograft Rejection | |||||
Regulation of toll-like receptor signaling pathway | |||||
References | |||||
Ref 536292 | Selective abrogation of Th1 response by STA-5326, a potent IL-12/IL-23 inhibitor. Blood. 2007 Feb 1;109(3):1156-64. Epub 2006 Oct 19. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.