Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T91023
|
||||
Former ID |
TTDI02163
|
||||
Target Name |
Roof plate-specific spondin 1
|
||||
Gene Name |
RSPO1
|
||||
Synonyms |
R-spondin-1; hRspo1; RSPO1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Gastrointestinal disease [ICD10: K00-K93] | ||||
Function |
Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. Also regulates the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential roles in ovary determination.
|
||||
BioChemical Class |
R-spondin
|
||||
UniProt ID | |||||
Sequence |
MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKL
FILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYL HKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVL HAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSR RRKGQQQQQQQGTVGPLTSAGPA |
||||
Drugs and Mode of Action | |||||
Modulator | NU-206 | Drug Info | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
Pathway Interaction Database | Wnt signaling network | ||||
Reactome | Regulation of FZD by ubiquitination | ||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.