Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T92030
|
||||
Former ID |
TTDNC00443
|
||||
Target Name |
Human pro-islet peptide
|
||||
Gene Name |
REG3A
|
||||
Synonyms |
HIP/PAP; Hepatointestinal pancreatic protein; Human proislet peptide; Pancreatitis-associated protein 1; REG-3-alpha; Reg III-alpha; Regenerating islet-derived protein 3-alpha; Regenerating islet-derived protein 3-alpha 15 kDa form; Regenerating islet-derived protein III-alpha; REG3A
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Liver failure [ICD10: K72.9] | ||||
Type 1/2 diabetes [ICD9: 250, 278; ICD10: E08-E13] | |||||
Function |
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.
|
||||
BioChemical Class |
Regiii family
|
||||
UniProt ID | |||||
Sequence |
MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKS
WTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGW EWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.