Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T51223
|
||||
Former ID |
TTDNC00371
|
||||
Target Name |
IL-21
|
||||
Gene Name |
IL21
|
||||
Synonyms |
Interleukin21; Za11; IL21
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
Colorectal cancer [ICD9: 153, 154; ICD10: C18-C21] | |||||
Function |
Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells (By similarity). May play a role in proliferation and maturation of natural killer (NK) cellsin synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation.
|
||||
BioChemical Class |
Cytokine: interleukin
|
||||
UniProt ID | |||||
Sequence |
MERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDV
ETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDS YEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
Jak-STAT signaling pathway | |||||
Inflammatory bowel disease (IBD) | |||||
PANTHER Pathway | Interleukin signaling pathway | ||||
WikiPathways | Allograft Rejection | ||||
References | |||||
Ref 468116 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4987). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.