Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T01851
|
||||
| Former ID |
TTDC00148
|
||||
| Target Name |
Integrin beta-1
|
||||
| Gene Name |
ITGB1
|
||||
| Synonyms |
Beta(1) integrin; CD29 antigen; Fibronectin receptor beta subunit; Integrin VLA-4 beta subunit; ITGB1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Macular degeneration [ICD9: 362.5; ICD10: H35.3] | ||||
| Non-small cell lung cancer [ICD10: C33-C34] | |||||
| Function |
Integrins alpha-1/beta-1, alpha-2/beta-1, alpha-10/beta- 1 and alpha-11/beta-1 are receptors for collagen, and integrins alpha- 1/beta-1 and alpha-2/beta-2 recognize the proline-hydroxylated sequence g-f-p-g-e-r in collagen.
|
||||
| BioChemical Class |
Integrin
|
||||
| Target Validation |
T01851
|
||||
| UniProt ID | |||||
| Sequence |
MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL SANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT CTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVEN PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN PIYKSAVTTVVNPKYEGK |
||||
| Structure |
1K11; 1LHA; 3G9W; 3T9K; 3VI3; 3VI4; 4DX9; 4WJK; 4WK0; 4WK2; 4WK4
|
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Rap1 signaling pathway | ||||
| Phagosome | |||||
| PI3K-Akt signaling pathway | |||||
| Axon guidance | |||||
| Focal adhesion | |||||
| ECM-receptor interaction | |||||
| Cell adhesion molecules (CAMs) | |||||
| Platelet activation | |||||
| Leukocyte transendothelial migration | |||||
| Regulation of actin cytoskeleton | |||||
| Bacterial invasion of epithelial cells | |||||
| Pathogenic Escherichia coli infection | |||||
| Shigellosis | |||||
| Pertussis | |||||
| Leishmaniasis | |||||
| Toxoplasmosis | |||||
| Pathways in cancer | |||||
| Proteoglycans in cancer | |||||
| Small cell lung cancer | |||||
| Hypertrophic cardiomyopathy (HCM) | |||||
| Arrhythmogenic right ventricular cardiomyopathy (ARVC) | |||||
| Dilated cardiomyopathy | |||||
| PANTHER Pathway | Inflammation mediated by chemokine and cytokine signaling pathway | ||||
| Integrin signalling pathway | |||||
| CCKR signaling map ST | |||||
| Pathway Interaction Database | Signaling events mediated by PRL | ||||
| RhoA signaling pathway | |||||
| Beta1 integrin cell surface interactions | |||||
| Integrin family cell surface interactions | |||||
| Arf6 trafficking events | |||||
| Reelin signaling pathway | |||||
| Signaling events mediated by TCPTP | |||||
| Angiopoietin receptor Tie2-mediated signaling | |||||
| Alpha9 beta1 integrin signaling events | |||||
| CXCR4-mediated signaling events | |||||
| Plexin-D1 Signaling | |||||
| Syndecan-4-mediated signaling events | |||||
| Urokinase-type plasminogen activator (uPA) and uPAR-mediated signaling | |||||
| a4b7 Integrin signaling | |||||
| a6b1 and a6b4 Integrin signaling | |||||
| Syndecan-2-mediated signaling events | |||||
| Validated targets of C-MYC transcriptional repression | |||||
| VEGFR3 signaling in lymphatic endothelium | |||||
| Alpha4 beta1 integrin signaling events | |||||
| Signaling events mediated by focal adhesion kinase | |||||
| Reactome | Elastic fibre formation | ||||
| Fibronectin matrix formation | |||||
| Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | |||||
| Cell surface interactions at the vascular wall | |||||
| Basigin interactions | |||||
| Molecules associated with elastic fibres | |||||
| Integrin cell surface interactions | |||||
| Laminin interactions | |||||
| Syndecan interactions | |||||
| ECM proteoglycans | |||||
| Other semaphorin interactions | |||||
| Localization of the PINCH-ILK-PARVIN complex to focal adhesions | |||||
| CHL1 interactions | |||||
| RHO GTPases Activate Formins | |||||
| Platelet Adhesion to exposed collagen | |||||
| WikiPathways | TGF beta Signaling Pathway | ||||
| Signaling of Hepatocyte Growth Factor Receptor | |||||
| Focal Adhesion | |||||
| Organogenesis (Part 2 of 3) | |||||
| Extracellular matrix organization | |||||
| Elastic fibre formation | |||||
| Nanoparticle-mediated activation of receptor signaling | |||||
| JAK/STAT | |||||
| Primary Focal Segmental Glomerulosclerosis FSGS | |||||
| Pathogenic Escherichia coli infection | |||||
| Arrhythmogenic Right Ventricular Cardiomyopathy | |||||
| Neural Crest Differentiation | |||||
| Semaphorin interactions | |||||
| Platelet Adhesion to exposed collagen | |||||
| Integrin-mediated Cell Adhesion | |||||
| L1CAM interactions | |||||
| Integrin cell surface interactions | |||||
| Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | |||||
| Cell surface interactions at the vascular wall | |||||
| Cell junction organization | |||||
| References | |||||
| Ref 525536 | Bioorg Med Chem Lett. 1999 Jul 5;9(13):1807-12.Orally bioavailable nonpeptide vitronectin receptor antagonists with efficacy in an osteoporosis model. | ||||
| Ref 529125 | J Med Chem. 2007 Nov 29;50(24):5878-81. Epub 2007 Nov 1.Multiple N-methylation by a designed approach enhances receptor selectivity. | ||||
| Ref 530343 | Bioorg Med Chem Lett. 2009 Oct 1;19(19):5803-6. Epub 2009 Jul 28.Discovery of N-{N-[(3-cyanobenzene) sulfonyl]-4(R)-(3,3-difluoropiperidin-1-yl)-(l)-prolyl}-4-[(3',5'-dichloro-isonicotinoyl) amino]-(l)-phenylalanine (MK-0617), a highly potent and orally active VLA-4 antagonist. | ||||
| Ref 532756 | Radretumab radioimmunotherapy in patients with brain metastasis: a 124I-L19SIP dosimetric PET study. Cancer Immunol Res. 2013 Aug;1(2):134-43. | ||||
| Ref 536198 | Suppression and regression of choroidal neovascularization by systemic administration of an alpha5beta1 integrin antagonist. Mol Pharmacol. 2006 Jun;69(6):1820-8. Epub 2006 Mar 9. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.