Target Information

Target General Infomation
Target ID
T06841
Former ID
TTDI01808
Target Name
Interleukin-23 ligand
Gene Name
IL23A
Synonyms
IL-23; Interleukin 23; P40 subunit of interleukin-23; IL23A
Target Type
Successful
Disease Ankylosing spondylitis [ICD9: 720; ICD10: M08.1, M45]
Asthma [ICD10: J45]
Crohn's disease; Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51]
Crohn's disease [ICD9: 555; ICD10: K50]
Hairy cell leukemia; Psoriasis [ICD9:202.4, 696; ICD10: C91.4, L40]
Moderate-to-severe plaque psoriasis [ICD9: 696; ICD10: L40]
Psoriasis [ICD9: 696; ICD10: L40]
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
Function
Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine- activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC.
BioChemical Class
Cytokine: interleukin
UniProt ID
Q9NPF7
Sequence
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSP
Structure
3D85; 3D87; 3DUH; 3QWR; 4GRW; 4OE8; 4OG9; 1F45; 3HMX
Drugs and Mode of Action
Drug(s) CNTO-1959 Drug Info Approved Moderate-to-severe plaque psoriasis [889446]
Ustekinumab Drug Info Approved Moderate-to-severe plaque psoriasis [530677], [541942]
CNTO-1959 Drug Info Phase 3 Asthma [542911], [548978]
MK-3222 Drug Info Phase 3 Hairy cell leukemia; Psoriasis [524424], [542967]
Ustekinumab Drug Info Phase 3 Psoriasis [530677], [541942]
Ustekinumab Drug Info Phase 2/3 Crohn's disease; Inflammatory bowel disease [530677], [541942]
BI 655066 Drug Info Phase 2 Ankylosing spondylitis [525187]
CNT0-1959 Drug Info Phase 2 Rheumatoid arthritis [551042]
AMG-139 Drug Info Phase 1 Crohn's disease [523286]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Jak-STAT signaling pathway
Type I diabetes mellitus
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Measles
Influenza A
Herpes simplex infection
Inflammatory bowel disease (IBD)
Allograft rejection
WikiPathways Toll-like receptor signaling pathway
Aryl Hydrocarbon Receptor Pathway
Allograft Rejection
Regulation of toll-like receptor signaling pathway
References
Ref 523286ClinicalTrials.gov (NCT01258205) Multiple Ascending Doses of AMG 139 in Healthy and Crohn's Disease Subjects. U.S. National Institutes of Health.
Ref 524424ClinicalTrials.gov (NCT01936688) A Study to Evaluate the Efficacy and Safety/Tolerability of Subcutaneous MK-3222 in Participants With Moderate-to-Severe Chronic Plaque Psoriasis (MK-3222-012). U.S. National Institutes of Health.
Ref 525187ClinicalTrials.gov (NCT02443298) Efficacy and Safety of BI 655066 in Patients With Severe Persistent Asthma.. U.S. National Institutes of Health.
Ref 530677Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
Ref 541942(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6885).
Ref 542911(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7998).
Ref 542967(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8093).
Ref 548978Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031108)
Ref 551042Anti-Interleukin-23 Monoclonal Antibody Guselkumab Shows Significant Efficacy in Treatment of Moderate to Severe Plaque Psoriasis. Janssen Research & Development, LLC (Janssen). Mar 24, 2014.
Ref 889446Drugs@FDA (Edaravone)
Ref 530677Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
Ref 532948Preclinical development of AMG 139, a human antibody specifically targeting IL-23. Br J Pharmacol. 2015 Jan;172(1):159-72.
Ref 533178Anti-IL-23A mAb BI 655066 for treatment of moderate-to-severe psoriasis: Safety, efficacy, pharmacokinetics, and biomarker results of a single-rising-dose, randomized, double-blind, placebo-controlled trial. J Allergy Clin Immunol. 2015 Jul;136(1):116-124.e7.
Ref 533191Interleukin-23 in the pathogenesis and treatment of psoriasis. Skin Therapy Lett. 2015 Mar-Apr;20(2):1-4.
Ref 533261Tildrakizumab (MK-3222), an anti-interleukin-23p19 monoclonal antibody, improves psoriasis in a phase IIb randomized placebo-controlled trial. Br J Dermatol. 2015 Jun 3.
Ref 536371Emerging drugs to treat Crohn's disease. Expert Opin Emerg Drugs. 2007 Mar;12(1):49-59.
Ref 537117Emerging drugs for psoriasis. Expert Opin Emerg Drugs. 2009 Mar;14(1):145-63.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.