Target Information

Target General Infomation
Target ID
T11309
Former ID
TTDR00451
Target Name
C-C motif chemokine 2
Gene Name
CCL2
Synonyms
HC11; MCAF; MCP-1; MCP1; Monocyte Chemoattractant Protein 1; Monocyte chemoattractant protein-1; Monocyte chemotactic and activating factor; Monocyte chemotactic protein 1; Monocyte secretory protein JE; SCYA2; Small-inducible cytokine A2; CCL2
Target Type
Clinical Trial
Disease Asthma [ICD10: J45]
Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47]
Diabetic complication [ICD10: E08-E13]
Nephritis [ICD10: N00-N19, N25-N29]
Pulmonary fibrosis [ICD9: 515, 516.3; ICD10: J84.1]
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
Function
Chemotactic factor that attracts monocytes and basophils but not neutrophils or eosinophils. Augments monocyte anti-tumor activity. Has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis or atherosclerosis. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis.
BioChemical Class
Cytokine: CC chemokine
Target Validation
T11309
UniProt ID
P13500
Sequence
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
Drugs and Mode of Action
Drug(s) Bindarit Drug Info Phase 3 Nephritis [531744]
Carlumab Drug Info Phase 2 Pulmonary fibrosis [532844], [542685]
NOX-E36 Drug Info Phase 2 Diabetic complication [523824]
MCP-1 Drug Info Preclinical Rheumatoid arthritis [536223]
RS-504393 Drug Info Preclinical Chronic obstructive pulmonary disease [536223], [542757]
ABN-912 Drug Info Discontinued in Phase 1 Asthma [547919]
Inhibitor Bindarit Drug Info [531744]
MCP-1 Drug Info [536223]
NOX-E36 Drug Info [533216]
RS-504393 Drug Info [536223], [536549]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NOD-like receptor signaling pathway
TNF signaling pathway
Chagas disease (American trypanosomiasis)
Malaria
Influenza A
Herpes simplex infection
Rheumatoid arthritis
NetPath Pathway IL9 Signaling Pathway
IL5 Signaling Pathway
IL1 Signaling Pathway
TSH Signaling Pathway
TWEAK Signaling Pathway
IL4 Signaling Pathway
TNFalpha Signaling Pathway
TSLP Signaling Pathway
Leptin Signaling Pathway
RANKL Signaling Pathway
PANTHER Pathway Inflammation mediated by chemokine and cytokine signaling pathway
Pathway Interaction Database GMCSF-mediated signaling events
Validated transcriptional targets of AP1 family members Fra1 and Fra2
AP-1 transcription factor network
IL23-mediated signaling events
Reactome Chemokine receptors bind chemokines
ATF4 activates genes
WikiPathways IL1 and megakaryotyces in obesity
Activation of Genes by ATF4
Spinal Cord Injury
Oncostatin M Signaling Pathway
TNF alpha Signaling Pathway
TWEAK Signaling Pathway
IL-1 signaling pathway
GPCR ligand binding
Folate Metabolism
Vitamin B12 Metabolism
Selenium Micronutrient Network
References
Ref 523824ClinicalTrials.gov (NCT01547897) NOX-E36 in Patients With Type 2 Diabetes Mellitus and Albuminuria. U.S. National Institutes of Health.
Ref 531744Bindarit: an anti-inflammatory small molecule that modulates the NF?B pathway. Cell Cycle. 2012 Jan 1;11(1):159-69.
Ref 532844Carlumab, an anti-C-C chemokine ligand 2 monoclonal antibody, in combination with four chemotherapy regimens for the treatment of patients with solid tumors: an open-label, multicenter phase 1b study. Target Oncol. 2015 Mar;10(1):111-23.
Ref 536223Emerging drugs for the treatment of chronic obstructive pulmonary disease. Expert Opin Emerg Drugs. 2006 May;11(2):275-91.
Ref 542685(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 771).
Ref 542757(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 781).
Ref 547919Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020409)
Ref 528332A randomized controlled trial with an anti-CCL2 (anti-monocyte chemotactic protein 1) monoclonal antibody in patients with rheumatoid arthritis. Arthritis Rheum. 2006 Aug;54(8):2387-92.
Ref 531744Bindarit: an anti-inflammatory small molecule that modulates the NF?B pathway. Cell Cycle. 2012 Jan 1;11(1):159-69.
Ref 532844Carlumab, an anti-C-C chemokine ligand 2 monoclonal antibody, in combination with four chemotherapy regimens for the treatment of patients with solid tumors: an open-label, multicenter phase 1b study. Target Oncol. 2015 Mar;10(1):111-23.
Ref 533216Crystal structure of a mirror-image L-RNA aptamer (Spiegelmer) in complex with the natural L-protein target CCL2. Nat Commun. 2015 Apr 22;6:6923.
Ref 536223Emerging drugs for the treatment of chronic obstructive pulmonary disease. Expert Opin Emerg Drugs. 2006 May;11(2):275-91.
Ref 536549Privileged structures: a useful concept for the rational design of new lead drug candidates. Mini Rev Med Chem. 2007 Nov;7(11):1108-19.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.