Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T22995
|
||||
| Former ID |
TTDI02090
|
||||
| Target Name |
Hepcidin
|
||||
| Gene Name |
HAMP
|
||||
| Synonyms |
Hepc20; Hepc25; Hepcidin20; LEAP1; Liverexpressed antimicrobial peptide 1; PLTR; Putative liver tumor regressor; HAMP
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Anemia [ICD9: 280-285; ICD10: D50-D64] | ||||
| Function |
Has strong antimicrobial activity against E.coli ML35P N.cinereaand weaker against S.epidermidis, S.aureus and group b streptococcus bacteria. Active against the fungus C.albicans. No activity against P.aeruginosa (PubMed:11113131, PubMed:11034317).
|
||||
| BioChemical Class |
Hepcidin family
|
||||
| UniProt ID | |||||
| Sequence |
MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRD
THFPICIFCCGCCHRSKCGMCCKT |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | NOX-H94 | Drug Info | Phase 2 | Anemia | [1] |
| Hepcidin mab | Drug Info | Phase 1 | Anemia | [2] | |
| Inhibitor | NOX-H94 | Drug Info | [1] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| WikiPathways | Iron metabolism in placenta | ||||
| References | |||||
| REF 1 | The effects of the anti-hepcidin Spiegelmer NOX-H94 on inflammation-induced anemia in cynomolgus monkeys. Blood. 2013 Mar 21;121(12):2311-5. | ||||
| REF 2 | ClinicalTrials.gov (NCT01340976) A Phase 1 Study of LY2787106 in Cancer and Anemia. U.S. National Institutes of Health. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.