Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T23036
|
||||
Former ID |
TTDI02067
|
||||
Target Name |
Staphylococcus aureus Enoyl ACP reductase
|
||||
Gene Name |
fabI
|
||||
Synonyms |
ENR; Enoyl[acylcarrierprotein] reductase [NADPH] FabI; NADPHdependent enoylACP reductase; fabI
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | ||||
Methicillin-resistant staphylococcus aureus infection [ICD10: B95.62] | |||||
Staphylococcus aureus infection [ICD10: B95.6] | |||||
Function |
Catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP). It has a preference for a long chain (C12) substrate compared to the shorter (C4) acyl group. Involved in the elongation cycle of fatty acid which are used in the lipid metabolism (By similarity).
|
||||
BioChemical Class |
Short-chain dehydrogenases reductases
|
||||
UniProt ID | |||||
EC Number |
EC=1.3.1.10
|
||||
Sequence |
MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP DNIRVNAISASPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG VTGENIHVDSGFHAIK |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
DRM | DRM Info | ||||
Pathways | |||||
References | |||||
Ref 523897 | ClinicalTrials.gov (NCT01593761) Phase 2a Study of CG400549 for the Treatment of cABSSSI Caused by Methicillin-resistant Staphylococcus Aureus. U.S. National Institutes of Health. | ||||
Ref 528783 | In vitro activities of CG400549, a novel FabI inhibitor, against recently isolated clinical staphylococcal strains in Korea. Antimicrob Agents Chemother. 2007 Jul;51(7):2591-3. Epub 2007 Apr 9. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.