Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T28998
|
||||
Former ID |
TTDS00253
|
||||
Target Name |
Gonadotropin-releasing hormone
|
||||
Gene Name |
GNRH1
|
||||
Synonyms |
GnRH; Gonadoliberin; LH-RH; LHRH; Leutinizing-hormone-releasing hormone; Luliberin; GNRH1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Prostate cancer [ICD9: 185; ICD10: C61] | ||||
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
Function |
Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
|
||||
BioChemical Class |
Hormone
|
||||
Target Validation |
T28998
|
||||
UniProt ID | |||||
Sequence |
MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQR
FECTTHQPRSPLRDLKGALESLIEEETGQKKI |
||||
Drugs and Mode of Action | |||||
Drug(s) | CG201 | Drug Info | Phase 2 | Solid tumours | [1] |
Norelin | Drug Info | Discontinued in Phase 2 | Prostate cancer | [2] | |
Inhibitor | Anti-GnRH Spiegelmer | Drug Info | [3] | ||
Norelin | Drug Info | [4] | |||
Modulator | CG201 | Drug Info | [5] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | GnRH signaling pathway | ||||
Pathway Interaction Database | Nongenotropic Androgen signaling | ||||
Reactome | Hormone ligand-binding receptors | ||||
G alpha (q) signalling events | |||||
WikiPathways | Gastrin-CREB signalling pathway via PKC and MAPK | ||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References | |||||
REF 1 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015700) | ||||
REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011623) | ||||
REF 3 | In vivo properties of an anti-GnRH Spiegelmer: an example of an oligonucleotide-based therapeutic substance class. Proc Natl Acad Sci U S A. 2002 Jun 25;99(13):8898-902. Epub 2002 Jun 17. | ||||
REF 4 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011623) | ||||
REF 5 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.