Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T39321
|
||||
Former ID |
TTDR00995
|
||||
Target Name |
Glyceraldehyde 3-phosphate dehydrogenase, muscle
|
||||
Gene Name |
GAPDH
|
||||
Synonyms |
D-glyceraldehyde-3-phosphate dehydrogenase; GAPDH
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Lateral sclerosis [ICD10: G12.2] | ||||
Function |
Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively. Participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis. Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S-nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC. Modulates the organization and assembly of the cytoskeleton. Facilitates the CHP1-dependent microtubule and membrane associations through its ability to stimulate the binding of CHP1 to microtubules (By similarity). Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D- glyceroylphosphate. Component of the GAIT (gamma interferon- activated inhibitor of translation) complex which mediates interferon-gamma-induced transcript-selective translation inhibition in inflammation processes. Upon interferon-gamma treatment assembles into the GAIT complex which binds to stem loop-containing GAIT elements in the 3'-UTR of diverse inflammatory mRNAs (such as ceruplasmin) and suppresses their translation.
|
||||
BioChemical Class |
Glyceraldehyde-3-phosphate
|
||||
UniProt ID | |||||
EC Number |
EC 2.6.99.-
|
||||
Sequence |
MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTV
KAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI ISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHA ITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAG IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
BioCyc Pathway | Superpathway of conversion of glucose to acetyl CoA and entry into the TCA cycle | ||||
Gluconeogenesis | |||||
NADH repair | |||||
Glycolysis | |||||
KEGG Pathway | Glycolysis / Gluconeogenesis | ||||
Metabolic pathways | |||||
Biosynthesis of antibiotics | |||||
Carbon metabolism | |||||
Biosynthesis of amino acids | |||||
HIF-1 signaling pathway | |||||
Alzheimer' | |||||
s disease | |||||
NetPath Pathway | TCR Signaling Pathway | ||||
IL2 Signaling Pathway | |||||
TSH Signaling Pathway | |||||
PANTHER Pathway | Glycolysis | ||||
Huntington disease | |||||
Pathway Interaction Database | Validated targets of C-MYC transcriptional activation | ||||
PathWhiz Pathway | Glycerol Phosphate Shuttle | ||||
Glycolysis | |||||
Gluconeogenesis | |||||
Mitochondrial Electron Transport Chain | |||||
Warburg Effect | |||||
Reactome | Glycolysis | ||||
Gluconeogenesis | |||||
WikiPathways | SIDS Susceptibility Pathways | ||||
Glycolysis and Gluconeogenesis | |||||
Alzheimers Disease | |||||
Cori Cycle | |||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.