Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T57011
|
||||
| Former ID |
TTDC00192
|
||||
| Target Name |
mRNA of Intercellularadhesion molecule-1
|
||||
| Gene Name |
ICAM1
|
||||
| Synonyms |
CD54 antigen; ICAM-1; Major group rhinovirus receptor; ICAM1
|
||||
| Target Type |
Successful
|
||||
| Disease | Crohn's disease; Ulcerative colitis [ICD9: 555, 556, 556.9; ICD10: K50, K50-K52, K51] | ||||
| Pouchitis [ICD10: K91.8] | |||||
| Transplant rejection [ICD9: 279.5, 996; ICD10: D89.8, T86] | |||||
| Function |
ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans- endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. In case of rhinovirus infection acts as a cellular receptor for the virus.
|
||||
| BioChemical Class |
Target of antisense drug
|
||||
| Target Validation |
T57011
|
||||
| UniProt ID | |||||
| Sequence |
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP |
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | NF-kappa B signaling pathway | ||||
| Cell adhesion molecules (CAMs) | |||||
| Natural killer cell mediated cytotoxicity | |||||
| TNF signaling pathway | |||||
| Leukocyte transendothelial migration | |||||
| African trypanosomiasis | |||||
| Malaria | |||||
| Staphylococcus aureus infection | |||||
| Influenza A | |||||
| HTLV-I infection | |||||
| Epstein-Barr virus infection | |||||
| Rheumatoid arthritis | |||||
| Viral myocarditis | |||||
| NetPath Pathway | IL5 Signaling Pathway | ||||
| IL1 Signaling Pathway | |||||
| TSH Signaling Pathway | |||||
| IL6 Signaling Pathway | |||||
| IL2 Signaling Pathway | |||||
| ID Signaling Pathway | |||||
| TWEAK Signaling Pathway | |||||
| RANKL Signaling Pathway | |||||
| TNFalpha Signaling Pathway | |||||
| Pathway Interaction Database | Thromboxane A2 receptor signaling | ||||
| Glucocorticoid receptor regulatory network | |||||
| amb2 Integrin signaling | |||||
| Beta2 integrin cell surface interactions | |||||
| Reactome | Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | ||||
| Integrin cell surface interactions | |||||
| Interferon gamma signaling | |||||
| WikiPathways | Type II interferon signaling (IFNG) | ||||
| IL1 and megakaryotyces in obesity | |||||
| Human Complement System | |||||
| Spinal Cord Injury | |||||
| Interleukin-11 Signaling Pathway | |||||
| RANKL/RANK Signaling Pathway | |||||
| Integrin cell surface interactions | |||||
| Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | |||||
| Folate Metabolism | |||||
| Vitamin B12 Metabolism | |||||
| Selenium Micronutrient Network | |||||
| References | |||||
| Ref 529623 | Bioorg Med Chem Lett. 2008 Aug 15;18(16):4544-6. Epub 2008 Jul 15.Alkamides from the fruits of Piper longum and Piper nigrum displaying potent cell adhesion inhibition. | ||||
| Ref 531049 | Bioorg Med Chem Lett. 2010 Sep 1;20(17):5269-73. Epub 2010 Jul 23.Discovery of tetrahydroisoquinoline (THIQ) derivatives as potent and orally bioavailable LFA-1/ICAM-1 antagonists. | ||||
| Ref 549600 | US patent application no. 5,789,573, Antisense inhibition of ICAM-1, E-selectin, and CMV IE1/IE2. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.