Target Information

Target General Infomation
Target ID
T60526
Former ID
TTDR00722
Target Name
L-selectin
Gene Name
SELL
Synonyms
CD62L; Gp90-MEL; LAM-1; LECAM1; Leukocyte adhesion molecule-1; Leukocyte surface antigen Leu-8; Leukocyte-endothelial cell adhesion molecule 1; Lymph node homing receptor; TQ1; SELL
Target Type
Clinical Trial
Disease Asthma [ICD10: J45]
Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25]
Psoriasis [ICD9: 696; ICD10: L40]
Function
Cell surface adhesion protein. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
BioChemical Class
Selectin/LECAM
Target Validation
T60526
UniProt ID
P14151
Sequence
MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDN
YTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPN
NKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTC
NCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETT
CGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKK
TICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKK
GKKSKRSMNDPY
Drugs and Mode of Action
Drug(s) GMI-1070 Drug Info Phase 3 Asthma [530945], [531721], [543059]
Hu Dreg 55 Drug Info Terminated Psoriasis [545695]
PURPUROGALLIN Drug Info Terminated Discovery agent [546235]
Inhibitor 2,3,4-trihydroxybenzoic acid Drug Info [528676]
BAICALEIN Drug Info [528676]
GMI-1070 Drug Info [530945], [531721], [544142]
PURPUROGALLIN Drug Info [528676]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cell adhesion molecules (CAMs)
NetPath Pathway IL9 Signaling Pathway
IL2 Signaling Pathway
Leptin Signaling Pathway
Reactome Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Cell surface interactions at the vascular wall
WikiPathways Human Complement System
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Cell surface interactions at the vascular wall
References
Ref 530945GMI-1070, a novel pan-selectin antagonist, reverses acute vascular occlusions in sickle cell mice. Blood. 2010 Sep 9;116(10):1779-86.
Ref 531721Deal watch: Pfizer deal for selectin inhibitor highlights potential of glycomimetic drugs. Nat Rev Drug Discov. 2011 Dec 1;10(12):890.
Ref 543059(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8307).
Ref 545695Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004232)
Ref 546235Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007041)
Ref 528676J Med Chem. 2007 Mar 22;50(6):1101-15. Epub 2007 Feb 16.Rational design of novel, potent small molecule pan-selectin antagonists.
Ref 530945GMI-1070, a novel pan-selectin antagonist, reverses acute vascular occlusions in sickle cell mice. Blood. 2010 Sep 9;116(10):1779-86.
Ref 531721Deal watch: Pfizer deal for selectin inhibitor highlights potential of glycomimetic drugs. Nat Rev Drug Discov. 2011 Dec 1;10(12):890.
Ref 536574Therapeutic applications of aptamers. Expert Opin Investig Drugs. 2008 Jan;17(1):43-60.
Ref 544142GMI-1070, a novel pan-selectin antagonist, reverses acute vascular occlusions in sickle cell mice. Blood. 2010 September 9; 116(10): 1779-1786.
Ref 550826Clinical pipeline report, company report or official report of glycomimetics.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.