Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T68334
|
||||
Former ID |
TTDS00438
|
||||
Target Name |
Follicle stimulating hormone receptor
|
||||
Gene Name |
FSHR
|
||||
Synonyms |
FSH-R; Follitropin receptor; FSHR
|
||||
Target Type |
Successful
|
||||
Disease | African trypanosomiasis [ICD9: 86.5; ICD10: B56] | ||||
Contraception [ICD10: Z30] | |||||
Female infertility [ICD9: 628; ICD10: N97.0] | |||||
Ovarian cancer [ICD9: 183; ICD10: C56] | |||||
Function |
Receptor for follicle stimulating hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T68334
|
||||
UniProt ID | |||||
Sequence |
MALLLVSLLAFLSLGSGCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRV
IQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP NLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKN GIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLEN LKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQE VDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIM GYNILRVLIWFISILAITGNIIVLVILTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIAS VDIHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLDCK VQLRHAASVMVMGWIFAFAAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVL AFVVICGCYIHIYLTVRNPNIVSSSSDTRIAKRMAMLIFTDFLCMAPISFFAISASLKVP LITVSKAKILLVLFHPINSCANPFLYAIFTKNFRRDFFILLSKCGCYEMQAQIYRTETSS TVHNTHPRNGHCSSAPRVTNGSTYILVPLSHLAQN |
||||
Drugs and Mode of Action | |||||
Binder | Follitropin beta | Drug Info | [536881] | ||
Menotropins | Drug Info | [537880] | |||
Urofollitropin | Drug Info | [536117] | |||
Modulator | FSHR NAM | Drug Info | [543643] | ||
Long-acting FSH conjugate | Drug Info | [543643] | |||
PRX-111 | Drug Info | [534648] | |||
Recombinant follicle stimulating hormone | Drug Info | [543643] | |||
Agonist | Labeled FSH superagonist | Drug Info | [543643] | ||
Antagonist | Suramin | Drug Info | [536432], [536924] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | cAMP signaling pathway | ||||
Neuroactive ligand-receptor interaction | |||||
Ovarian steroidogenesis | |||||
PathWhiz Pathway | Vasopressin Regulation of Water Homeostasis | ||||
Intracellular Signalling Through FSH Receptor and Follicle Stimulating Hormone | |||||
Reactome | Hormone ligand-binding receptors | ||||
G alpha (s) signalling events | |||||
WikiPathways | GPCRs, Class A Rhodopsin-like | ||||
Ovarian Infertility Genes | |||||
Peptide GPCRs | |||||
FSH signaling pathway | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
GPCRs, Other | |||||
References | |||||
Ref 536135 | Opportunities and challenges in antiparasitic drug discovery. Nat Rev Drug Discov. 2005 Sep;4(9):727-40. | ||||
Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
Ref 534648 | A naturally occurring basically charged human follicle-stimulating hormone (FSH) variant inhibits FSH-induced androgen aromatization and tissue-type plasminogen activator enzyme activity in vitro. Neuroendocrinology. 1998 Mar;67(3):153-63. | ||||
Ref 536117 | Follicle-stimulating hormone in clinical practice: an update. Treat Endocrinol. 2004;3(3):161-71. | ||||
Ref 536432 | Follicle stimulating hormone receptor (FSHR) antagonist and epithelial ovarian cancer (EOC). J Exp Ther Oncol. 2007;6(3):201-4. | ||||
Ref 536881 | Follitropin-alpha (Gonal-F) versus follitropin-beta (Puregon) in controlled ovarian hyperstimulation for in vitro fertilization: is there any difference? Fertil Steril. 2009 Apr;91(4 Suppl):1522-5. Epub 2008 Oct 11. | ||||
Ref 536924 | Suramin: clinical uses and structure-activity relationships. Mini Rev Med Chem. 2008 Nov;8(13):1384-94. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.