Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T78114
|
||||
Former ID |
TTDI02050
|
||||
Target Name |
CD55
|
||||
Gene Name |
CD55
|
||||
Synonyms |
Complement decayaccelerating factor; CD55
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Colorectal cancer [ICD9: 153, 154; ICD10: C18-C21] | ||||
Gastric cancer [ICD9: 151; ICD10: C16] | |||||
Glioblastoma multiforme [ICD9: 191; ICD10: C71] | |||||
Function |
This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. {ECO:0000269|PubMed:7525274}.
|
||||
BioChemical Class |
Receptor of complement activation
|
||||
UniProt ID | |||||
Sequence |
MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTV
ITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFP VGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGI LFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGER DHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPT TVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLS GHTCFTLTGLLGTLVTMGLLT |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Complement and coagulation cascades | ||||
Hematopoietic cell lineage | |||||
Viral myocarditis | |||||
NetPath Pathway | IL5 Signaling Pathway | ||||
IL2 Signaling Pathway | |||||
FSH Signaling Pathway | |||||
TGF_beta_Receptor Signaling Pathway | |||||
Reactome | Class B/2 (Secretin family receptors) | ||||
Regulation of Complement cascade | |||||
WikiPathways | Complement and Coagulation Cascades | ||||
Complement Activation, Classical Pathway | |||||
Human Complement System | |||||
GPCR ligand binding | |||||
Complement cascade | |||||
References | |||||
Ref 528759 | Oncolytic Coxsackievirus A21 as a novel therapy for multiple myeloma. Br J Haematol. 2007 Apr;137(2):133-41. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.