Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T78381
|
||||
Former ID |
TTDI02296
|
||||
Target Name |
Interleukin-29 ligand
|
||||
Gene Name |
IFNL1
|
||||
Synonyms |
Cytokine Zcyto21; IFNlambda1; IL29; Interferon lambda1; Interleukin29; IFNL1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Acute myeloid leukemia [ICD9: 205; ICD10: C92.0] | ||||
Viral infections [ICD9: 054.0, 054.1, 054.2, 054.3, 075, 771.2, 052, 053; ICD10: B01, B02, A60, B00, B27, G05.1, P35.2] | |||||
Function |
Cytokine withantiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN- stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets: is primarily active in epithelial cells and this cell type- selective action is because of the epithelial cell-specific expression of its receptor IFNLR1. Exerts an immunomodulatory effect by up-regulating MHC class I antigen expression.
|
||||
BioChemical Class |
Cytokine: interferon
|
||||
UniProt ID | |||||
Sequence |
MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEES
LKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHT LHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRD LKYVADGNLCLRTSTHPEST |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
Jak-STAT signaling pathway | |||||
WikiPathways | Type III interferon signaling | ||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.