Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T85158
|
||||
Former ID |
TTDC00327
|
||||
Target Name |
Lymphotoxin alpha
|
||||
Gene Name |
LTA
|
||||
Synonyms |
LT-alpha; Lymphotoxin-alpha; TNF-beta; Tumor necrosis factor ligand superfamily member 1; LTA
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | ||||
Function |
Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumorcells in vitro and in vivo.
|
||||
BioChemical Class |
Cytokine: tumor necrosis factor
|
||||
UniProt ID | |||||
Sequence |
MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHST
LKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAY SPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQ LSTHTDGIPHLVLSPSTVFFGAFAL |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
NF-kappa B signaling pathway | |||||
TNF signaling pathway | |||||
Type I diabetes mellitus | |||||
HTLV-I infection | |||||
Herpes simplex infection | |||||
NetPath Pathway | TCR Signaling Pathway | ||||
IL2 Signaling Pathway | |||||
RANKL Signaling Pathway | |||||
PANTHER Pathway | Apoptosis signaling pathway | ||||
Pathway Interaction Database | IL4-mediated signaling events | ||||
IL2 signaling events mediated by STAT5 | |||||
Reactome | TNFR2 non-canonical NF-kB pathway | ||||
TNFs bind their physiological receptors | |||||
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway | |||||
WikiPathways | Apoptosis | ||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.